BLASTX nr result
ID: Stemona21_contig00040320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00040320 (629 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358628.1| hypothetical protein PhapfoPp082 [Phalaenopsis ... 70 5e-10 >ref|YP_358628.1| hypothetical protein PhapfoPp082 [Phalaenopsis aphrodite subsp. formosana] gi|58802845|gb|AAW82565.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 81 Score = 70.1 bits (170), Expect = 5e-10 Identities = 35/47 (74%), Positives = 37/47 (78%) Frame = +2 Query: 380 ECD*SIFCT*ERKATTGVGESEPKRGFFTSFSHSKPCMRLSSRTAPK 520 E + + F ERKATTGVGESE KRGF TS SHSKPCMRLS RTAPK Sbjct: 35 EAETATFEVTERKATTGVGESESKRGFLTSLSHSKPCMRLSPRTAPK 81