BLASTX nr result
ID: Stemona21_contig00040222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00040222 (539 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT00371.1| Putative auxin efflux carrier component 2 [Aegilo... 93 4e-17 dbj|BAJ97662.1| predicted protein [Hordeum vulgare subsp. vulgare] 93 4e-17 ref|XP_006656324.1| PREDICTED: probable auxin efflux carrier com... 92 6e-17 ref|XP_004965663.1| PREDICTED: probable auxin efflux carrier com... 92 6e-17 ref|NP_001058268.1| Os06g0660200 [Oryza sativa Japonica Group] g... 92 6e-17 ref|XP_002437402.1| hypothetical protein SORBIDRAFT_10g026300 [S... 92 6e-17 gb|EAZ37887.1| hypothetical protein OsJ_22236 [Oryza sativa Japo... 92 6e-17 gb|EAZ01958.1| hypothetical protein OsI_23989 [Oryza sativa Indi... 92 6e-17 gb|AFK32342.1| putative auxin efflux carrier PIN2 [Zea mays] 92 8e-17 ref|XP_003563339.1| PREDICTED: probable auxin efflux carrier com... 92 8e-17 ref|XP_006366195.1| PREDICTED: LOW QUALITY PROTEIN: auxin efflux... 92 1e-16 ref|NP_001234170.1| auxin efflux facilitator SlPIN2 [Solanum lyc... 92 1e-16 ref|XP_002324677.2| auxin efflux carrier component 2 family prot... 91 2e-16 ref|XP_006474301.1| PREDICTED: auxin efflux carrier component 2-... 90 3e-16 gb|EOY32116.1| Auxin efflux carrier family protein [Theobroma ca... 90 3e-16 ref|XP_004299793.1| PREDICTED: auxin efflux carrier component 2-... 90 3e-16 ref|XP_002975037.1| hypothetical protein SELMODRAFT_102666 [Sela... 90 3e-16 ref|XP_002977457.1| hypothetical protein SELMODRAFT_443592 [Sela... 90 3e-16 ref|NP_568848.1| auxin efflux carrier component 2 [Arabidopsis t... 90 4e-16 ref|XP_006280155.1| hypothetical protein CARUB_v10026053mg [Caps... 90 4e-16 >gb|EMT00371.1| Putative auxin efflux carrier component 2 [Aegilops tauschii] Length = 559 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGMLVALPITILYYVLLG+ Sbjct: 514 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLVALPITILYYVLLGI 559 >dbj|BAJ97662.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 627 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGMLVALPITILYYVLLG+ Sbjct: 582 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLVALPITILYYVLLGI 627 >ref|XP_006656324.1| PREDICTED: probable auxin efflux carrier component 2-like [Oryza brachyantha] Length = 627 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGML+ALPITILYYVLLG+ Sbjct: 582 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILYYVLLGI 627 >ref|XP_004965663.1| PREDICTED: probable auxin efflux carrier component 2-like [Setaria italica] Length = 629 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGML+ALPITILYYVLLG+ Sbjct: 584 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILYYVLLGI 629 >ref|NP_001058268.1| Os06g0660200 [Oryza sativa Japonica Group] gi|75114357|sp|Q651V6.1|PIN2_ORYSJ RecName: Full=Probable auxin efflux carrier component 2; AltName: Full=OsPIN2 gi|52077371|dbj|BAD46411.1| putative auxin efflux carrier protein [Oryza sativa Japonica Group] gi|113596308|dbj|BAF20182.1| Os06g0660200 [Oryza sativa Japonica Group] gi|215715198|dbj|BAG94949.1| unnamed protein product [Oryza sativa Japonica Group] gi|294831566|tpd|FAA00680.1| TPA: auxin efflux carrier [Oryza sativa Japonica Group] Length = 630 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGML+ALPITILYYVLLG+ Sbjct: 585 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILYYVLLGI 630 >ref|XP_002437402.1| hypothetical protein SORBIDRAFT_10g026300 [Sorghum bicolor] gi|241915625|gb|EER88769.1| hypothetical protein SORBIDRAFT_10g026300 [Sorghum bicolor] Length = 626 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGML+ALPITILYYVLLG+ Sbjct: 581 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILYYVLLGI 626 >gb|EAZ37887.1| hypothetical protein OsJ_22236 [Oryza sativa Japonica Group] Length = 639 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGML+ALPITILYYVLLG+ Sbjct: 594 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILYYVLLGI 639 >gb|EAZ01958.1| hypothetical protein OsI_23989 [Oryza sativa Indica Group] Length = 640 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGML+ALPITILYYVLLG+ Sbjct: 595 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILYYVLLGI 640 >gb|AFK32342.1| putative auxin efflux carrier PIN2 [Zea mays] Length = 625 Score = 92.0 bits (227), Expect = 8e-17 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGML+ALPITILYY+LLG+ Sbjct: 580 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILYYILLGI 625 >ref|XP_003563339.1| PREDICTED: probable auxin efflux carrier component 2-like [Brachypodium distachyon] Length = 645 Score = 92.0 bits (227), Expect = 8e-17 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYNCHP ILSTAVIFGML+ALPITILYY+LLG+ Sbjct: 600 ALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILYYILLGI 645 >ref|XP_006366195.1| PREDICTED: LOW QUALITY PROTEIN: auxin efflux carrier component 2-like [Solanum tuberosum] Length = 622 Score = 91.7 bits (226), Expect = 1e-16 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPDILSTAVIFGMLVALPITILYYVLLGV Sbjct: 577 ALPQGIVPFVFAKEYNLHPDILSTAVIFGMLVALPITILYYVLLGV 622 >ref|NP_001234170.1| auxin efflux facilitator SlPIN2 [Solanum lycopersicum] gi|312983226|gb|ADR30409.1| auxin efflux facilitator SlPIN2 [Solanum lycopersicum] Length = 631 Score = 91.7 bits (226), Expect = 1e-16 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPDILSTAVIFGMLVALPITILYYVLLGV Sbjct: 586 ALPQGIVPFVFAKEYNLHPDILSTAVIFGMLVALPITILYYVLLGV 631 >ref|XP_002324677.2| auxin efflux carrier component 2 family protein [Populus trichocarpa] gi|550318679|gb|EEF03242.2| auxin efflux carrier component 2 family protein [Populus trichocarpa] Length = 633 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPDILSTAVIFGML+ALPIT+LYYVLLGV Sbjct: 588 ALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITVLYYVLLGV 633 >ref|XP_006474301.1| PREDICTED: auxin efflux carrier component 2-like [Citrus sinensis] Length = 646 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPDILSTAVIFGML+ALPITILYYVLLG+ Sbjct: 601 ALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITILYYVLLGL 646 >gb|EOY32116.1| Auxin efflux carrier family protein [Theobroma cacao] Length = 634 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPDILSTAVIFGML+ALPITILYYVLLG+ Sbjct: 589 ALPQGIVPFVFAKEYNVHPDILSTAVIFGMLIALPITILYYVLLGL 634 >ref|XP_004299793.1| PREDICTED: auxin efflux carrier component 2-like [Fragaria vesca subsp. vesca] Length = 646 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPDILSTAVIFGMLVALPITILYY+LLG+ Sbjct: 601 ALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPITILYYILLGL 646 >ref|XP_002975037.1| hypothetical protein SELMODRAFT_102666 [Selaginella moellendorffii] gi|300157196|gb|EFJ23822.1| hypothetical protein SELMODRAFT_102666 [Selaginella moellendorffii] Length = 602 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPD+LSTAVIFGMLVALPIT+LYYVLLG+ Sbjct: 557 ALPQGIVPFVFAKEYNVHPDVLSTAVIFGMLVALPITLLYYVLLGI 602 >ref|XP_002977457.1| hypothetical protein SELMODRAFT_443592 [Selaginella moellendorffii] gi|300154827|gb|EFJ21461.1| hypothetical protein SELMODRAFT_443592 [Selaginella moellendorffii] Length = 716 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPD+LSTAVIFGMLVALPIT+LYYVLLG+ Sbjct: 671 ALPQGIVPFVFAKEYNVHPDVLSTAVIFGMLVALPITLLYYVLLGI 716 >ref|NP_568848.1| auxin efflux carrier component 2 [Arabidopsis thaliana] gi|42558886|sp|Q9LU77.2|PIN2_ARATH RecName: Full=Auxin efflux carrier component 2; Short=AtPIN2; AltName: Full=Auxin efflux carrier AGR; AltName: Full=Ethylene-insensitive root 1; Short=AtEIR1; AltName: Full=Polar-auxin-transport efflux component AGR1; AltName: Full=Protein AGRAVITROPIC 1; Short=AtAGR1; AltName: Full=Protein WAVY 6 gi|3377507|gb|AAC39513.1| auxin transport protein EIR1 [Arabidopsis thaliana] gi|3661620|gb|AAC61781.1| putative auxin efflux carrier AGR [Arabidopsis thaliana] gi|3746886|gb|AAC84042.1| polar-auxin-transport efflux component AGRAVITROPIC 1 [Arabidopsis thaliana] gi|4206709|gb|AAD11780.1| root gravitropism control protein [Arabidopsis thaliana] gi|19310454|gb|AAL84962.1| AT5g57090/MUL3_3 [Arabidopsis thaliana] gi|24797062|gb|AAN64543.1| At5g57090/MUL3_3 [Arabidopsis thaliana] gi|51970858|dbj|BAD44121.1| root gravitropism control protein (PIN2) [Arabidopsis thaliana] gi|332009462|gb|AED96845.1| auxin efflux carrier component 2 [Arabidopsis thaliana] Length = 647 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPDILSTAVIFGMLVALP+T+LYYVLLG+ Sbjct: 602 ALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPVTVLYYVLLGL 647 >ref|XP_006280155.1| hypothetical protein CARUB_v10026053mg [Capsella rubella] gi|482548859|gb|EOA13053.1| hypothetical protein CARUB_v10026053mg [Capsella rubella] Length = 655 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 3 ALPQGIVPFVFAKEYNCHPDILSTAVIFGMLVALPITILYYVLLGV 140 ALPQGIVPFVFAKEYN HPDILSTAVIFGMLVALP+T+LYYVLLG+ Sbjct: 610 ALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPVTVLYYVLLGL 655