BLASTX nr result
ID: Stemona21_contig00040006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00040006 (345 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836789.1| hypothetical protein AMTR_s00088p00177890 [A... 72 6e-11 >ref|XP_006836789.1| hypothetical protein AMTR_s00088p00177890 [Amborella trichopoda] gi|548839349|gb|ERM99642.1| hypothetical protein AMTR_s00088p00177890 [Amborella trichopoda] Length = 671 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = +1 Query: 1 LSHLSNCIGSMTWAPQRKYASKLLKVLGKLAVFGKGKGKTRQGASSPSNVSETCRS-NPL 177 L H+S+CIGSM+W RKYA++LLKV K+ G GK K +Q AS+P+ C + NP+ Sbjct: 610 LGHVSSCIGSMSWVSHRKYANRLLKVFYKIRALGWGKSKRKQAASTPN----PCHTLNPI 665 Query: 178 HEIYDC 195 H+IYDC Sbjct: 666 HDIYDC 671