BLASTX nr result
ID: Stemona21_contig00039223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00039223 (516 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838808.1| hypothetical protein AMTR_s00002p00261540 [A... 58 1e-06 ref|XP_002520785.1| dead box ATP-dependent RNA helicase, putativ... 58 1e-06 ref|XP_004148172.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 57 3e-06 emb|CBI25423.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002273715.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 57 3e-06 gb|EPS62883.1| hypothetical protein M569_11905, partial [Genlise... 56 4e-06 ref|XP_003569064.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 56 4e-06 gb|EMS48901.1| DEAD-box ATP-dependent RNA helicase 18 [Triticum ... 56 6e-06 dbj|BAJ89697.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 gb|ESW35572.1| hypothetical protein PHAVU_001G246000g [Phaseolus... 55 7e-06 ref|NP_001042102.1| Os01g0164500 [Oryza sativa Japonica Group] g... 55 1e-05 ref|XP_006645526.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 55 1e-05 ref|XP_002312182.1| DEAD/DEAH box helicase family protein [Popul... 55 1e-05 gb|EEC69998.1| hypothetical protein OsI_00527 [Oryza sativa Indi... 55 1e-05 >ref|XP_006838808.1| hypothetical protein AMTR_s00002p00261540 [Amborella trichopoda] gi|548841314|gb|ERN01377.1| hypothetical protein AMTR_s00002p00261540 [Amborella trichopoda] Length = 642 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 112 LLPFWLKQILVLDEADRLLDMGFQKQITSILSRLPKL 2 +L F +IL+LDEADRLLDMGFQKQITSI+SRLPKL Sbjct: 160 VLDFRNLEILILDEADRLLDMGFQKQITSIMSRLPKL 196 >ref|XP_002520785.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223539916|gb|EEF41494.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Length = 592 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 112 LLPFWLKQILVLDEADRLLDMGFQKQITSILSRLPKL 2 +L F ++L+LDEADRLLDMGFQKQITSI+SRLPKL Sbjct: 163 ILDFRNLEVLILDEADRLLDMGFQKQITSIISRLPKL 199 >ref|XP_004148172.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 18-like [Cucumis sativus] gi|449515784|ref|XP_004164928.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 18-like [Cucumis sativus] Length = 587 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 91 QILVLDEADRLLDMGFQKQITSILSRLPKL 2 ++L+LDEADRLLDMGFQKQITSI+SRLPKL Sbjct: 167 EVLILDEADRLLDMGFQKQITSIISRLPKL 196 >emb|CBI25423.3| unnamed protein product [Vitis vinifera] Length = 576 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 112 LLPFWLKQILVLDEADRLLDMGFQKQITSILSRLPKL 2 +L F +IL+LDEADRLLDMGFQKQITSI++RLPKL Sbjct: 165 VLDFRNLEILILDEADRLLDMGFQKQITSIIARLPKL 201 >ref|XP_002273715.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 18-like [Vitis vinifera] Length = 595 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 112 LLPFWLKQILVLDEADRLLDMGFQKQITSILSRLPKL 2 +L F +IL+LDEADRLLDMGFQKQITSI++RLPKL Sbjct: 165 VLDFRNLEILILDEADRLLDMGFQKQITSIIARLPKL 201 >gb|EPS62883.1| hypothetical protein M569_11905, partial [Genlisea aurea] Length = 505 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 109 LPFWLKQILVLDEADRLLDMGFQKQITSILSRLPKL 2 L F +IL+LDEADRLLDMGFQKQI+SI+SRLPKL Sbjct: 107 LDFRSFEILILDEADRLLDMGFQKQISSIISRLPKL 142 >ref|XP_003569064.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 18-like [Brachypodium distachyon] Length = 644 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -3 Query: 91 QILVLDEADRLLDMGFQKQITSILSRLPKL 2 +IL+LDEADRLLDMGFQKQITSI+S+LPKL Sbjct: 173 EILILDEADRLLDMGFQKQITSIISKLPKL 202 >gb|EMS48901.1| DEAD-box ATP-dependent RNA helicase 18 [Triticum urartu] Length = 669 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 91 QILVLDEADRLLDMGFQKQITSILSRLPKL 2 +IL+LDEADRLLDMGFQKQ+TSI+S+LPKL Sbjct: 361 EILILDEADRLLDMGFQKQVTSIISKLPKL 390 >dbj|BAJ89697.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 643 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 91 QILVLDEADRLLDMGFQKQITSILSRLPKL 2 +IL+LDEADRLLDMGFQKQ+TSI+S+LPKL Sbjct: 176 EILILDEADRLLDMGFQKQVTSIISKLPKL 205 >gb|ESW35572.1| hypothetical protein PHAVU_001G246000g [Phaseolus vulgaris] Length = 588 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 112 LLPFWLKQILVLDEADRLLDMGFQKQITSILSRLPKL 2 +L F +IL+LDEADRLLDMGFQKQIT+I+S+LPKL Sbjct: 160 VLDFKNLEILILDEADRLLDMGFQKQITAIISQLPKL 196 >ref|NP_001042102.1| Os01g0164500 [Oryza sativa Japonica Group] gi|143361417|sp|Q761Z9.2|RH18_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 18; AltName: Full=BRI1-KD-interacting protein 115; Short=BIP115 gi|15528747|dbj|BAB64789.1| putative RNA helicase [Oryza sativa Japonica Group] gi|21327991|dbj|BAC00580.1| putative RNA helicase [Oryza sativa Japonica Group] gi|113531633|dbj|BAF04016.1| Os01g0164500 [Oryza sativa Japonica Group] gi|125569150|gb|EAZ10665.1| hypothetical protein OsJ_00495 [Oryza sativa Japonica Group] gi|215697070|dbj|BAG91064.1| unnamed protein product [Oryza sativa Japonica Group] gi|215737306|dbj|BAG96235.1| unnamed protein product [Oryza sativa Japonica Group] Length = 647 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 91 QILVLDEADRLLDMGFQKQITSILSRLPKL 2 +IL+LDEADRLLD+GFQKQITSI+S+LPKL Sbjct: 175 EILILDEADRLLDLGFQKQITSIISKLPKL 204 >ref|XP_006645526.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 18-like [Oryza brachyantha] Length = 648 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 91 QILVLDEADRLLDMGFQKQITSILSRLPKL 2 +IL+LDEADRLLD+GFQKQITSI+S+LPKL Sbjct: 176 EILILDEADRLLDLGFQKQITSIISKLPKL 205 >ref|XP_002312182.1| DEAD/DEAH box helicase family protein [Populus trichocarpa] gi|222852002|gb|EEE89549.1| DEAD/DEAH box helicase family protein [Populus trichocarpa] Length = 592 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 112 LLPFWLKQILVLDEADRLLDMGFQKQITSILSRLPKL 2 +L F ++L+LDEADRLLDMGFQKQ+ SI+SRLPKL Sbjct: 162 VLDFRNLEVLILDEADRLLDMGFQKQLNSIISRLPKL 198 >gb|EEC69998.1| hypothetical protein OsI_00527 [Oryza sativa Indica Group] Length = 648 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 91 QILVLDEADRLLDMGFQKQITSILSRLPKL 2 +IL+LDEADRLLD+GFQKQITSI+S+LPKL Sbjct: 176 EILILDEADRLLDLGFQKQITSIISKLPKL 205