BLASTX nr result
ID: Stemona21_contig00038726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00038726 (558 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433095.1| hypothetical protein CICLE_v10001604mg [Citr... 64 3e-08 >ref|XP_006433095.1| hypothetical protein CICLE_v10001604mg [Citrus clementina] gi|557535217|gb|ESR46335.1| hypothetical protein CICLE_v10001604mg [Citrus clementina] Length = 363 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/97 (36%), Positives = 47/97 (48%), Gaps = 15/97 (15%) Frame = +2 Query: 257 YTKYESATEDAEEPKVINTGGWERPNRAGWSVPPQVNLTKAATNNIGVAANYLMQ----- 421 Y Y EP V N+GGW RP RAGW VPP +L+ + TN+I A YL + Sbjct: 238 YDNYYHNNGSRTEPTVTNSGGWTRPTRAGWGVPPDASLS-SPTNDINTAVRYLQEGARPT 296 Query: 422 ----------SPPVSYQSTNGSATKTIDSNEAAKKYG 502 + P++ +TIDS EAA++YG Sbjct: 297 SVTTAPQSRVTVPITTGPRRDDYGQTIDSREAARRYG 333