BLASTX nr result
ID: Stemona21_contig00038639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00038639 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW79402.1| hypothetical protein ZEAMMB73_015523 [Zea mays] 55 1e-05 dbj|BAJ99410.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 1e-05 emb|CAA03959.1| unnamed protein product [Hordeum vulgare subsp. ... 55 1e-05 emb|CAD59411.1| SMC3 protein [Oryza sativa] 55 1e-05 >gb|AFW79402.1| hypothetical protein ZEAMMB73_015523 [Zea mays] Length = 1173 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 471 PAPFYLFDEIDAALDPQYRTAVGSI 397 PAPFYLFDEIDAALDPQYRTAVGSI Sbjct: 1142 PAPFYLFDEIDAALDPQYRTAVGSI 1166 >dbj|BAJ99410.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 427 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 471 PAPFYLFDEIDAALDPQYRTAVGSI 397 PAPFYLFDEIDAALDPQYRTAVGSI Sbjct: 374 PAPFYLFDEIDAALDPQYRTAVGSI 398 >emb|CAA03959.1| unnamed protein product [Hordeum vulgare subsp. vulgare] Length = 147 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 471 PAPFYLFDEIDAALDPQYRTAVGSIHNFNSD 379 PAPFYLFDEIDAALDPQYRTAVGS+ +D Sbjct: 64 PAPFYLFDEIDAALDPQYRTAVGSVVRLLAD 94 >emb|CAD59411.1| SMC3 protein [Oryza sativa] Length = 1205 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 471 PAPFYLFDEIDAALDPQYRTAVGSI 397 PAPFYLFDEIDAALDPQYRTAVGSI Sbjct: 1120 PAPFYLFDEIDAALDPQYRTAVGSI 1144