BLASTX nr result
ID: Stemona21_contig00038061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00038061 (733 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_085484.1| hypothetical protein ArthMp012 [Arabidopsis tha... 75 1e-13 >ref|NP_085484.1| hypothetical protein ArthMp012 [Arabidopsis thaliana] gi|44888109|sp|P93282.1|M130_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg00130; AltName: Full=ORF121a gi|1785684|emb|CAA69758.1| unnamed protein product [Arabidopsis thaliana] Length = 121 Score = 74.7 bits (182), Expect(2) = 1e-13 Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 1/62 (1%) Frame = +3 Query: 354 NLMESDSLTANSQ-APDYRTTYSYLSSPSVTKLAPLTLTTGDDFTVTLSVTPAMNSPESK 530 N+ + SL+ +S + R T SYLSSPSVT+LAPLTLTTGDDFTVTLSVTP MNS ES+ Sbjct: 12 NMRINSSLSKSSTFSTRLRITDSYLSSPSVTELAPLTLTTGDDFTVTLSVTPTMNSLESQ 71 Query: 531 VI 536 VI Sbjct: 72 VI 73 Score = 28.1 bits (61), Expect(2) = 1e-13 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 536 ICPRAYDCKE 565 ICPRAYDCKE Sbjct: 73 ICPRAYDCKE 82