BLASTX nr result
ID: Stemona21_contig00037859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00037859 (269 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432679.1| hypothetical protein CICLE_v10000923mg [Citr... 59 7e-07 ref|XP_006432678.1| hypothetical protein CICLE_v10000923mg [Citr... 59 7e-07 gb|EOY25236.1| GHMP kinase family protein [Theobroma cacao] 58 1e-06 tpg|DAA44420.1| TPA: phosphomevalonate kinase [Zea mays] 58 1e-06 tpg|DAA44419.1| TPA: hypothetical protein ZEAMMB73_212283 [Zea m... 58 1e-06 gb|AFW88953.1| hypothetical protein ZEAMMB73_488047 [Zea mays] 58 1e-06 gb|AFW88952.1| hypothetical protein ZEAMMB73_488047, partial [Ze... 58 1e-06 gb|ADR65112.1| 5-phosphomevalonate kinase [Catharanthus roseus] 58 1e-06 ref|XP_002465546.1| hypothetical protein SORBIDRAFT_01g040900 [S... 58 1e-06 ref|XP_002275808.1| PREDICTED: phosphomevalonate kinase [Vitis v... 58 1e-06 gb|ACN31689.1| unknown [Zea mays] gi|413956305|gb|AFW88954.1| ph... 58 1e-06 ref|XP_002520206.1| ATP binding protein, putative [Ricinus commu... 58 1e-06 ref|NP_001149345.1| phosphomevalonate kinase [Zea mays] gi|19562... 58 1e-06 ref|NP_001266751.1| phosphomevalonate kinase [Zea mays] gi|19562... 58 1e-06 emb|CAN70293.1| hypothetical protein VITISV_005973 [Vitis vinifera] 58 1e-06 gb|AAL18926.1|AF429385_1 phosphomevalonate kinase [Hevea brasili... 58 1e-06 ref|XP_006365967.1| PREDICTED: phosphomevalonate kinase-like [So... 57 2e-06 ref|XP_006352929.1| PREDICTED: phosphomevalonate kinase-like [So... 57 2e-06 ref|XP_006368341.1| GHMP kinase family protein [Populus trichoca... 57 2e-06 ref|XP_006368340.1| hypothetical protein POPTR_0001s01790g [Popu... 57 2e-06 >ref|XP_006432679.1| hypothetical protein CICLE_v10000923mg [Citrus clementina] gi|568834769|ref|XP_006471475.1| PREDICTED: phosphomevalonate kinase-like [Citrus sinensis] gi|557534801|gb|ESR45919.1| hypothetical protein CICLE_v10000923mg [Citrus clementina] Length = 504 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLITGGYLILERPNAGIVLST AR Sbjct: 5 ASAPGKVLITGGYLILERPNAGIVLSTNAR 34 >ref|XP_006432678.1| hypothetical protein CICLE_v10000923mg [Citrus clementina] gi|557534800|gb|ESR45918.1| hypothetical protein CICLE_v10000923mg [Citrus clementina] Length = 385 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLITGGYLILERPNAGIVLST AR Sbjct: 5 ASAPGKVLITGGYLILERPNAGIVLSTNAR 34 >gb|EOY25236.1| GHMP kinase family protein [Theobroma cacao] Length = 507 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYLILERPNAGIVLST AR Sbjct: 5 ASAPGKVLMTGGYLILERPNAGIVLSTNAR 34 >tpg|DAA44420.1| TPA: phosphomevalonate kinase [Zea mays] Length = 499 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLI GGYL+LERPNAG+VLSTTAR Sbjct: 5 ASAPGKVLIAGGYLVLERPNAGLVLSTTAR 34 >tpg|DAA44419.1| TPA: hypothetical protein ZEAMMB73_212283 [Zea mays] Length = 511 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLI GGYL+LERPNAG+VLSTTAR Sbjct: 5 ASAPGKVLIAGGYLVLERPNAGLVLSTTAR 34 >gb|AFW88953.1| hypothetical protein ZEAMMB73_488047 [Zea mays] Length = 501 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLI GGYL+LERPNAG+VLSTTAR Sbjct: 5 ASAPGKVLIAGGYLVLERPNAGLVLSTTAR 34 >gb|AFW88952.1| hypothetical protein ZEAMMB73_488047, partial [Zea mays] Length = 64 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLI GGYL+LERPNAG+VLSTTAR Sbjct: 5 ASAPGKVLIAGGYLVLERPNAGLVLSTTAR 34 >gb|ADR65112.1| 5-phosphomevalonate kinase [Catharanthus roseus] Length = 498 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYLILERPNAGIVLST AR Sbjct: 5 ASAPGKVLMTGGYLILERPNAGIVLSTNAR 34 >ref|XP_002465546.1| hypothetical protein SORBIDRAFT_01g040900 [Sorghum bicolor] gi|241919400|gb|EER92544.1| hypothetical protein SORBIDRAFT_01g040900 [Sorghum bicolor] Length = 512 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLI GGYL+LERPNAG+VLSTTAR Sbjct: 5 ASAPGKVLIAGGYLVLERPNAGLVLSTTAR 34 >ref|XP_002275808.1| PREDICTED: phosphomevalonate kinase [Vitis vinifera] gi|297742018|emb|CBI33805.3| unnamed protein product [Vitis vinifera] Length = 508 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYLILERPNAGIVLST AR Sbjct: 5 ASAPGKVLMTGGYLILERPNAGIVLSTNAR 34 >gb|ACN31689.1| unknown [Zea mays] gi|413956305|gb|AFW88954.1| phosphomevalonate kinase [Zea mays] Length = 512 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLI GGYL+LERPNAG+VLSTTAR Sbjct: 5 ASAPGKVLIAGGYLVLERPNAGLVLSTTAR 34 >ref|XP_002520206.1| ATP binding protein, putative [Ricinus communis] gi|223540698|gb|EEF42261.1| ATP binding protein, putative [Ricinus communis] Length = 503 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYLILERPNAGIVLST AR Sbjct: 5 ASAPGKVLMTGGYLILERPNAGIVLSTNAR 34 >ref|NP_001149345.1| phosphomevalonate kinase [Zea mays] gi|195626562|gb|ACG35111.1| phosphomevalonate kinase [Zea mays] Length = 512 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLI GGYL+LERPNAG+VLSTTAR Sbjct: 5 ASAPGKVLIAGGYLVLERPNAGLVLSTTAR 34 >ref|NP_001266751.1| phosphomevalonate kinase [Zea mays] gi|195626356|gb|ACG35008.1| phosphomevalonate kinase [Zea mays] Length = 499 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVLI GGYL+LERPNAG+VLSTTAR Sbjct: 5 ASAPGKVLIAGGYLVLERPNAGLVLSTTAR 34 >emb|CAN70293.1| hypothetical protein VITISV_005973 [Vitis vinifera] Length = 613 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYLILERPNAGIVLST AR Sbjct: 5 ASAPGKVLMTGGYLILERPNAGIVLSTNAR 34 >gb|AAL18926.1|AF429385_1 phosphomevalonate kinase [Hevea brasiliensis] Length = 503 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYLILERPNAGIVLST AR Sbjct: 5 ASAPGKVLMTGGYLILERPNAGIVLSTNAR 34 >ref|XP_006365967.1| PREDICTED: phosphomevalonate kinase-like [Solanum tuberosum] Length = 509 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYL+LERPNAGIVLST AR Sbjct: 5 ASAPGKVLMTGGYLVLERPNAGIVLSTNAR 34 >ref|XP_006352929.1| PREDICTED: phosphomevalonate kinase-like [Solanum tuberosum] Length = 509 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYL+LERPNAGIVLST AR Sbjct: 5 ASAPGKVLMTGGYLVLERPNAGIVLSTNAR 34 >ref|XP_006368341.1| GHMP kinase family protein [Populus trichocarpa] gi|550346248|gb|ERP64910.1| GHMP kinase family protein [Populus trichocarpa] Length = 507 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYLILERPNAG+VLST AR Sbjct: 5 ASAPGKVLMTGGYLILERPNAGVVLSTNAR 34 >ref|XP_006368340.1| hypothetical protein POPTR_0001s01790g [Populus trichocarpa] gi|550346247|gb|ERP64909.1| hypothetical protein POPTR_0001s01790g [Populus trichocarpa] Length = 503 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 ASAPGKVLITGGYLILERPNAGIVLSTTAR 267 ASAPGKVL+TGGYLILERPNAG+VLST AR Sbjct: 5 ASAPGKVLMTGGYLILERPNAGVVLSTNAR 34