BLASTX nr result
ID: Stemona21_contig00035761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00035761 (563 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360658.1| PREDICTED: methyl-CpG-binding domain-contain... 76 5e-12 ref|XP_004240123.1| PREDICTED: methyl-CpG-binding domain-contain... 76 5e-12 ref|XP_003517246.1| PREDICTED: methyl-CpG-binding domain-contain... 75 1e-11 ref|XP_004966103.1| PREDICTED: methyl-CpG-binding domain-contain... 74 2e-11 dbj|BAD53782.1| methyl-binding domain protein-like [Oryza sativa... 74 2e-11 ref|XP_006583579.1| PREDICTED: methyl-CpG-binding domain-contain... 74 2e-11 ref|NP_001058488.2| Os06g0702100 [Oryza sativa Japonica Group] g... 74 2e-11 ref|XP_002263085.1| PREDICTED: methyl-CpG-binding domain-contain... 74 2e-11 gb|EAZ38189.1| hypothetical protein OsJ_22540 [Oryza sativa Japo... 74 2e-11 ref|XP_006403073.1| hypothetical protein EUTSA_v10003457mg [Eutr... 74 2e-11 ref|XP_006403072.1| hypothetical protein EUTSA_v10003457mg [Eutr... 74 2e-11 ref|XP_006403071.1| hypothetical protein EUTSA_v10003457mg [Eutr... 74 2e-11 gb|ESW24988.1| hypothetical protein PHAVU_004G177500g [Phaseolus... 74 3e-11 ref|XP_006284211.1| hypothetical protein CARUB_v10005368mg [Caps... 73 4e-11 ref|XP_006284210.1| hypothetical protein CARUB_v10005368mg [Caps... 73 4e-11 ref|XP_002526239.1| DNA binding protein, putative [Ricinus commu... 73 4e-11 ref|XP_002437542.1| hypothetical protein SORBIDRAFT_10g029100 [S... 72 7e-11 ref|XP_006656450.1| PREDICTED: methyl-CpG-binding domain-contain... 72 9e-11 ref|XP_006656449.1| PREDICTED: methyl-CpG-binding domain-contain... 72 9e-11 ref|XP_006453191.1| hypothetical protein CICLE_v10008843mg [Citr... 72 9e-11 >ref|XP_006360658.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X1 [Solanum tuberosum] gi|565389846|ref|XP_006360659.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X2 [Solanum tuberosum] Length = 332 Score = 76.3 bits (186), Expect = 5e-12 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKAQP 181 YY+ P G +LRSM +VE+YL E Y G+++SQFSF+ PRPLQ NYV+KR Y+ P Sbjct: 216 YYVAPSGKRLRSMVEVEKYLQEHPDYVAQGVSMSQFSFQIPRPLQDNYVKKRPYRPALAP 275 Query: 182 D 184 D Sbjct: 276 D 276 >ref|XP_004240123.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Solanum lycopersicum] Length = 332 Score = 76.3 bits (186), Expect = 5e-12 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKAQP 181 YY+ P G +LRSM +VE+YL E Y G+++SQFSF+ PRPLQ NYV+KR Y+ P Sbjct: 216 YYVAPSGKRLRSMVEVEKYLQEHPDYVAQGVSMSQFSFQIPRPLQDNYVKKRPYRPALAP 275 Query: 182 D 184 D Sbjct: 276 D 276 >ref|XP_003517246.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X1 [Glycine max] gi|571433478|ref|XP_006572918.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X2 [Glycine max] gi|571433481|ref|XP_006572919.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X3 [Glycine max] Length = 312 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKR 157 YYI P G +LRSM +V+++L E Y RDG+ LSQFSF+ PRPLQ NYVRKR Sbjct: 192 YYIAPSGKRLRSMVEVQKFLMEHPEYTRDGVTLSQFSFQIPRPLQENYVRKR 243 >ref|XP_004966103.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Setaria italica] Length = 322 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRK 154 YY +P G KLRS+ ++ RYL E HY R+G+NLSQFSF TP+PLQ +YVRK Sbjct: 190 YYTSPSGKKLRSLVEIGRYLKENPHYIREGVNLSQFSFATPKPLQEDYVRK 240 >dbj|BAD53782.1| methyl-binding domain protein-like [Oryza sativa Japonica Group] Length = 399 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQY 163 YY +P G KLRS+ +V RYL E HY R G+NL+QFSF TP+PLQ +YVRK Y Sbjct: 240 YYTSPTGKKLRSLVEVGRYLAENPHYIRQGVNLTQFSFATPKPLQEDYVRKHTY 293 >ref|XP_006583579.1| PREDICTED: methyl-CpG-binding domain-containing protein 2 isoform X1 [Glycine max] gi|571466156|ref|XP_006583580.1| PREDICTED: methyl-CpG-binding domain-containing protein 2 isoform X2 [Glycine max] gi|571466158|ref|XP_006583581.1| PREDICTED: methyl-CpG-binding domain-containing protein 2 isoform X3 [Glycine max] gi|571466160|ref|XP_006583582.1| PREDICTED: methyl-CpG-binding domain-containing protein 2 isoform X4 [Glycine max] Length = 309 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKR 157 YYI P G +LRSM +++++L E Y RDG+ LSQFSF+ PRPLQ NYVRKR Sbjct: 192 YYIAPSGKRLRSMVEIQKFLMEHPEYTRDGVTLSQFSFQIPRPLQENYVRKR 243 >ref|NP_001058488.2| Os06g0702100 [Oryza sativa Japonica Group] gi|255677371|dbj|BAF20402.2| Os06g0702100 [Oryza sativa Japonica Group] Length = 373 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQY 163 YY +P G KLRS+ +V RYL E HY R G+NL+QFSF TP+PLQ +YVRK Y Sbjct: 214 YYTSPTGKKLRSLVEVGRYLAENPHYIRQGVNLTQFSFATPKPLQEDYVRKHTY 267 >ref|XP_002263085.1| PREDICTED: methyl-CpG-binding domain-containing protein 2 [Vitis vinifera] gi|297736061|emb|CBI24099.3| unnamed protein product [Vitis vinifera] Length = 354 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/80 (47%), Positives = 48/80 (60%), Gaps = 1/80 (1%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKA-Q 178 YY+ P G +LRSM +V++YL E Y G+ LSQFSF+ P+PLQ NYVRKR + A Sbjct: 201 YYVAPSGKRLRSMVEVQKYLLEHPEYMVHGVTLSQFSFQIPKPLQENYVRKRPARVNAGS 260 Query: 179 PDNGVGSKFHTPPEPVAVTP 238 D+ S P EP V P Sbjct: 261 YDDTTSSGMSRPLEPGEVNP 280 >gb|EAZ38189.1| hypothetical protein OsJ_22540 [Oryza sativa Japonica Group] Length = 359 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQY 163 YY +P G KLRS+ +V RYL E HY R G+NL+QFSF TP+PLQ +YVRK Y Sbjct: 200 YYTSPTGKKLRSLVEVGRYLAENPHYIRQGVNLTQFSFATPKPLQEDYVRKHTY 253 >ref|XP_006403073.1| hypothetical protein EUTSA_v10003457mg [Eutrema salsugineum] gi|557104180|gb|ESQ44526.1| hypothetical protein EUTSA_v10003457mg [Eutrema salsugineum] Length = 258 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/62 (51%), Positives = 44/62 (70%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKAQP 181 YY++P G KLRS +V++YLN+ Y R+G+ LSQFSF+ P+PLQ +YVRKR + Sbjct: 184 YYVSPSGKKLRSSVEVQKYLNDHPQYIREGVKLSQFSFQIPKPLQHDYVRKRPTRLMEST 243 Query: 182 DN 187 DN Sbjct: 244 DN 245 >ref|XP_006403072.1| hypothetical protein EUTSA_v10003457mg [Eutrema salsugineum] gi|557104179|gb|ESQ44525.1| hypothetical protein EUTSA_v10003457mg [Eutrema salsugineum] Length = 297 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/62 (51%), Positives = 44/62 (70%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKAQP 181 YY++P G KLRS +V++YLN+ Y R+G+ LSQFSF+ P+PLQ +YVRKR + Sbjct: 184 YYVSPSGKKLRSSVEVQKYLNDHPQYIREGVKLSQFSFQIPKPLQHDYVRKRPTRLMEST 243 Query: 182 DN 187 DN Sbjct: 244 DN 245 >ref|XP_006403071.1| hypothetical protein EUTSA_v10003457mg [Eutrema salsugineum] gi|557104178|gb|ESQ44524.1| hypothetical protein EUTSA_v10003457mg [Eutrema salsugineum] Length = 290 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/62 (51%), Positives = 44/62 (70%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKAQP 181 YY++P G KLRS +V++YLN+ Y R+G+ LSQFSF+ P+PLQ +YVRKR + Sbjct: 177 YYVSPSGKKLRSSVEVQKYLNDHPQYIREGVKLSQFSFQIPKPLQHDYVRKRPTRLMEST 236 Query: 182 DN 187 DN Sbjct: 237 DN 238 >gb|ESW24988.1| hypothetical protein PHAVU_004G177500g [Phaseolus vulgaris] Length = 315 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKR 157 YY+ P G +LRSM +++++L+E Y RDG+ LSQFSF+ P+PLQ NYVRKR Sbjct: 191 YYVAPSGKRLRSMIEIQKFLSEHPEYARDGVTLSQFSFQIPKPLQENYVRKR 242 >ref|XP_006284211.1| hypothetical protein CARUB_v10005368mg [Capsella rubella] gi|482552916|gb|EOA17109.1| hypothetical protein CARUB_v10005368mg [Capsella rubella] Length = 297 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/62 (50%), Positives = 43/62 (69%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKAQP 181 YY++P G KLRS +V++YLN+ Y R G+ +SQFSF+ P+PLQ +YVRKR + Sbjct: 175 YYVSPSGKKLRSTVEVQKYLNDNPEYTRQGVKISQFSFQIPKPLQDDYVRKRPARLMESS 234 Query: 182 DN 187 DN Sbjct: 235 DN 236 >ref|XP_006284210.1| hypothetical protein CARUB_v10005368mg [Capsella rubella] gi|482552915|gb|EOA17108.1| hypothetical protein CARUB_v10005368mg [Capsella rubella] Length = 288 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/62 (50%), Positives = 43/62 (69%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKAQP 181 YY++P G KLRS +V++YLN+ Y R G+ +SQFSF+ P+PLQ +YVRKR + Sbjct: 175 YYVSPSGKKLRSTVEVQKYLNDNPEYTRQGVKISQFSFQIPKPLQDDYVRKRPARLMESS 234 Query: 182 DN 187 DN Sbjct: 235 DN 236 >ref|XP_002526239.1| DNA binding protein, putative [Ricinus communis] gi|223534433|gb|EEF36136.1| DNA binding protein, putative [Ricinus communis] Length = 271 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/62 (54%), Positives = 42/62 (67%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKAQP 181 YY P G +LRSM ++ERYL Y ++G+ LSQFSF+ PRPLQ NYVRKR + A Sbjct: 200 YYQAPSGKRLRSMVEIERYLMANPEYVQNGVKLSQFSFQIPRPLQENYVRKRPARLTASC 259 Query: 182 DN 187 DN Sbjct: 260 DN 261 >ref|XP_002437542.1| hypothetical protein SORBIDRAFT_10g029100 [Sorghum bicolor] gi|241915765|gb|EER88909.1| hypothetical protein SORBIDRAFT_10g029100 [Sorghum bicolor] Length = 348 Score = 72.4 bits (176), Expect = 7e-11 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQY 163 YY +P G KLRS+ ++ RYL + HY R+G+NLSQFSF TP+PLQ +YV+K + Sbjct: 189 YYTSPSGKKLRSLVEIGRYLEQNPHYIREGVNLSQFSFATPKPLQEDYVQKHTF 242 >ref|XP_006656450.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X2 [Oryza brachyantha] gi|573948291|ref|XP_006656451.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X3 [Oryza brachyantha] gi|573948293|ref|XP_006656452.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X4 [Oryza brachyantha] Length = 355 Score = 72.0 bits (175), Expect = 9e-11 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQY 163 YY +P G KLRS+ ++ RYL E H+ ++G+NL+QFSF TP+PLQ +YVRK Y Sbjct: 200 YYTSPSGKKLRSLVEIGRYLAENPHFIKEGVNLTQFSFATPKPLQEDYVRKHTY 253 >ref|XP_006656449.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X1 [Oryza brachyantha] Length = 362 Score = 72.0 bits (175), Expect = 9e-11 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQY 163 YY +P G KLRS+ ++ RYL E H+ ++G+NL+QFSF TP+PLQ +YVRK Y Sbjct: 207 YYTSPSGKKLRSLVEIGRYLAENPHFIKEGVNLTQFSFATPKPLQEDYVRKHTY 260 >ref|XP_006453191.1| hypothetical protein CICLE_v10008843mg [Citrus clementina] gi|567922372|ref|XP_006453192.1| hypothetical protein CICLE_v10008843mg [Citrus clementina] gi|568840729|ref|XP_006474318.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X1 [Citrus sinensis] gi|568840731|ref|XP_006474319.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X2 [Citrus sinensis] gi|568840733|ref|XP_006474320.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X3 [Citrus sinensis] gi|568840735|ref|XP_006474321.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X4 [Citrus sinensis] gi|568840737|ref|XP_006474322.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X5 [Citrus sinensis] gi|568840739|ref|XP_006474323.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like isoform X6 [Citrus sinensis] gi|557556417|gb|ESR66431.1| hypothetical protein CICLE_v10008843mg [Citrus clementina] gi|557556418|gb|ESR66432.1| hypothetical protein CICLE_v10008843mg [Citrus clementina] Length = 340 Score = 72.0 bits (175), Expect = 9e-11 Identities = 39/81 (48%), Positives = 48/81 (59%), Gaps = 2/81 (2%) Frame = +2 Query: 2 YYITPCGMKLRSMTDVERYLNERAHYKRDGINLSQFSFRTPRPLQANYVRKRQYKCKAQP 181 YY P G KLRSM ++++YL E Y R G+ +SQFSF+ P+PLQ NYVRKR K Sbjct: 206 YYEAPSGKKLRSMVEIQKYLLEHPEYARAGVKMSQFSFQIPKPLQENYVRKRVSKAHTSH 265 Query: 182 DNGVGSKFHTPP--EPVAVTP 238 D TP EP AV+P Sbjct: 266 D--------TPKALEPRAVSP 278