BLASTX nr result
ID: Stemona21_contig00035236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00035236 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34226.1| unknown [Lotus japonicus] 69 5e-10 ref|XP_006577244.1| PREDICTED: uncharacterized protein LOC100780... 69 9e-10 ref|XP_003626291.1| Chaperone protein dnaJ [Medicago truncatula]... 68 1e-09 ref|XP_004156421.1| PREDICTED: putative pentatricopeptide repeat... 67 2e-09 ref|XP_004139176.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 gb|EMJ06980.1| hypothetical protein PRUPE_ppa010503mg [Prunus pe... 67 2e-09 gb|ESW19044.1| hypothetical protein PHAVU_006G091900g [Phaseolus... 67 3e-09 ref|XP_004962163.1| PREDICTED: uncharacterized protein LOC101774... 67 3e-09 ref|XP_002439759.1| hypothetical protein SORBIDRAFT_09g019580 [S... 67 3e-09 gb|EOY11339.1| Chaperone DnaJ-domain superfamily protein [Theobr... 66 4e-09 ref|XP_002512380.1| pentatricopeptide repeat-containing protein,... 66 4e-09 ref|XP_006344631.1| PREDICTED: cysteine string protein-like isof... 66 6e-09 ref|XP_006344630.1| PREDICTED: cysteine string protein-like isof... 66 6e-09 ref|XP_004230210.1| PREDICTED: uncharacterized protein LOC101245... 66 6e-09 ref|XP_006472016.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 ref|XP_006433325.1| hypothetical protein CICLE_v10002196mg [Citr... 65 9e-09 gb|AFW77912.1| hypothetical protein ZEAMMB73_222711 [Zea mays] 65 9e-09 gb|AFW77911.1| hypothetical protein ZEAMMB73_222711 [Zea mays] 65 9e-09 ref|NP_001149610.1| dnaJ domain containing protein [Zea mays] gi... 65 9e-09 ref|XP_002280795.2| PREDICTED: uncharacterized protein LOC100263... 65 1e-08 >gb|AFK34226.1| unknown [Lotus japonicus] Length = 253 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/54 (68%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR +LE L+S L APYD + EA LLYSLI+KAKFENNRY KPK+QP ST Sbjct: 194 TPSQRILLEELLDSILDAPYDISAEADLLYSLITKAKFENNRYQKPKKQPKTST 247 >ref|XP_006577244.1| PREDICTED: uncharacterized protein LOC100780594 [Glycine max] Length = 251 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP 147 TP QR +LE L+S L APYD + EA LLYSLI+KAKFENNRY KPK+QP Sbjct: 192 TPSQRILLEELLDSTLEAPYDTSAEADLLYSLITKAKFENNRYQKPKKQP 241 >ref|XP_003626291.1| Chaperone protein dnaJ [Medicago truncatula] gi|355501306|gb|AES82509.1| Chaperone protein dnaJ [Medicago truncatula] Length = 251 Score = 67.8 bits (164), Expect = 1e-09 Identities = 36/54 (66%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR ILE LNS + APYD + EA LLYSLI+KAKFENNRY KPK++ ST Sbjct: 192 TPSQRIILEELLNSIIDAPYDTSAEADLLYSLITKAKFENNRYQKPKKKTKFST 245 >ref|XP_004156421.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g68930-like [Cucumis sativus] Length = 833 Score = 67.4 bits (163), Expect = 2e-09 Identities = 37/54 (68%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR ILE L+SAL PYD + EA LLYSLI K+KFENNRY KPKR+P ST Sbjct: 774 TPLQRIILEELLDSALDVPYDNSAEADLLYSLIVKSKFENNRYKKPKREPKNST 827 >ref|XP_004139176.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Cucumis sativus] Length = 838 Score = 67.4 bits (163), Expect = 2e-09 Identities = 37/54 (68%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR ILE L+SAL PYD + EA LLYSLI K+KFENNRY KPKR+P ST Sbjct: 779 TPLQRIILEELLDSALDVPYDNSAEADLLYSLIVKSKFENNRYKKPKREPKNST 832 >gb|EMJ06980.1| hypothetical protein PRUPE_ppa010503mg [Prunus persica] Length = 247 Score = 67.0 bits (162), Expect = 2e-09 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR ILE L+S L PYD + EA LLYSLI KA+FENNRY KPK+QP ST Sbjct: 188 TPLQRIILEELLDSILNMPYDSSAEADLLYSLIVKARFENNRYRKPKKQPKAST 241 >gb|ESW19044.1| hypothetical protein PHAVU_006G091900g [Phaseolus vulgaris] Length = 247 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP 147 TP QR +LE L+S L APYD + +A LLYSLI+KAKFENNRY KP+RQP Sbjct: 188 TPSQRILLEELLDSILEAPYDTSADADLLYSLINKAKFENNRYQKPQRQP 237 >ref|XP_004962163.1| PREDICTED: uncharacterized protein LOC101774289 [Setaria italica] Length = 261 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEALLYSLISKAKFENNRYHKPKR 153 TPCQR ILE L S L APYD AE A+L SL++KAKFENNRY KPKR Sbjct: 203 TPCQRTILEDVLASVLMAPYDLAEAAVLDSLLTKAKFENNRYTKPKR 249 >ref|XP_002439759.1| hypothetical protein SORBIDRAFT_09g019580 [Sorghum bicolor] gi|241945044|gb|EES18189.1| hypothetical protein SORBIDRAFT_09g019580 [Sorghum bicolor] Length = 262 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/47 (72%), Positives = 36/47 (76%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEALLYSLISKAKFENNRYHKPKR 153 TPCQR ILE L S L PYD AE A+L SL+SKAKFENNRY KPKR Sbjct: 204 TPCQRTILEDVLASVLMPPYDIAEAAVLDSLLSKAKFENNRYRKPKR 250 >gb|EOY11339.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao] Length = 293 Score = 66.2 bits (160), Expect = 4e-09 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR ILE L+S L P+D + EA LLYSLI KAKFENNRY KPK+QP ST Sbjct: 234 TPSQRIILEELLDSILDKPFDTSAEADLLYSLIVKAKFENNRYQKPKKQPKTST 287 >ref|XP_002512380.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548341|gb|EEF49832.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 736 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/54 (64%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR ILE L+S LG PYD + EA +LYSLI KA +ENNRY KPK+QP ST Sbjct: 677 TPSQRIILEELLDSILGVPYDNSAEADMLYSLIVKATYENNRYQKPKKQPKTST 730 >ref|XP_006344631.1| PREDICTED: cysteine string protein-like isoform X2 [Solanum tuberosum] Length = 244 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/54 (62%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR +LE L S + PYD + EA LLYSLI KA+FENNRY KPK+QP ST Sbjct: 185 TPSQRIVLEELLGSIMSTPYDTSAEADLLYSLIVKARFENNRYQKPKKQPKAST 238 >ref|XP_006344630.1| PREDICTED: cysteine string protein-like isoform X1 [Solanum tuberosum] Length = 271 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/54 (62%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR +LE L S + PYD + EA LLYSLI KA+FENNRY KPK+QP ST Sbjct: 212 TPSQRIVLEELLGSIMSTPYDTSAEADLLYSLIVKARFENNRYQKPKKQPKAST 265 >ref|XP_004230210.1| PREDICTED: uncharacterized protein LOC101245500 [Solanum lycopersicum] Length = 271 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/54 (62%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR +LE L S + PYD + EA LLYSLI KA+FENNRY KPK+QP ST Sbjct: 212 TPSQRIVLEELLGSIMSTPYDTSAEADLLYSLIVKARFENNRYQKPKKQPKAST 265 >ref|XP_006472016.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Citrus sinensis] Length = 899 Score = 65.1 bits (157), Expect = 9e-09 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP 147 TP QR ILE L S L APYD + EA LLYSLI KA+FENNRY KPK++P Sbjct: 840 TPSQRIILEELLESILDAPYDTSAEAELLYSLIVKARFENNRYQKPKKKP 889 >ref|XP_006433325.1| hypothetical protein CICLE_v10002196mg [Citrus clementina] gi|557535447|gb|ESR46565.1| hypothetical protein CICLE_v10002196mg [Citrus clementina] Length = 262 Score = 65.1 bits (157), Expect = 9e-09 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP 147 TP QR ILE L S L APYD + EA LLYSLI KA+FENNRY KPK++P Sbjct: 203 TPSQRIILEELLESILDAPYDTSAEAELLYSLIVKARFENNRYQKPKKKP 252 >gb|AFW77912.1| hypothetical protein ZEAMMB73_222711 [Zea mays] Length = 114 Score = 65.1 bits (157), Expect = 9e-09 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEALLYSLISKAKFENNRYHKPKR 153 TPCQR ILE L S L PYD AE A+L SL+SKAKFENNRY KP+R Sbjct: 56 TPCQRTILEDVLASVLMVPYDLAEAAVLDSLLSKAKFENNRYKKPQR 102 >gb|AFW77911.1| hypothetical protein ZEAMMB73_222711 [Zea mays] Length = 199 Score = 65.1 bits (157), Expect = 9e-09 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEALLYSLISKAKFENNRYHKPKR 153 TPCQR ILE L S L PYD AE A+L SL+SKAKFENNRY KP+R Sbjct: 141 TPCQRTILEDVLASVLMVPYDLAEAAVLDSLLSKAKFENNRYKKPQR 187 >ref|NP_001149610.1| dnaJ domain containing protein [Zea mays] gi|223975903|gb|ACN32139.1| unknown [Zea mays] gi|413945261|gb|AFW77910.1| dnaJ domain containing protein [Zea mays] Length = 258 Score = 65.1 bits (157), Expect = 9e-09 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEALLYSLISKAKFENNRYHKPKR 153 TPCQR ILE L S L PYD AE A+L SL+SKAKFENNRY KP+R Sbjct: 200 TPCQRTILEDVLASVLMVPYDLAEAAVLDSLLSKAKFENNRYKKPQR 246 >ref|XP_002280795.2| PREDICTED: uncharacterized protein LOC100263014 [Vitis vinifera] gi|296088328|emb|CBI36773.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/54 (64%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -2 Query: 293 TPCQRAILEVQLNSALGAPYDPAEEA-LLYSLISKAKFENNRYHKPKRQP*LST 135 TP QR +LE L+S L PYD + EA LLYSLI KA+FENNRY KPK QP ST Sbjct: 206 TPSQRIVLEELLDSILDTPYDTSAEADLLYSLIVKARFENNRYQKPKNQPKGST 259