BLASTX nr result
ID: Stemona21_contig00032754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00032754 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB57573.1| hypothetical protein L484_022680 [Morus notabilis] 56 4e-06 >gb|EXB57573.1| hypothetical protein L484_022680 [Morus notabilis] Length = 110 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/75 (40%), Positives = 45/75 (60%) Frame = +2 Query: 158 YQRLSNEAERASSSRPKRRWLRRINGGMIAFRLSTARRVKWRRFSAIVLSQRAIEFYAEI 337 Y+RLSN E+ + +P R W+++ NG + RLS +R++ + FS +V + R Y EI Sbjct: 18 YERLSNIDEKVT--KPGRCWVKKTNGKLKGLRLSRSRKLTLKVFSVVVFTNRIARIYNEI 75 Query: 338 GNMMKMMDGAHPTII 382 N M +DG HP II Sbjct: 76 VNRMS-IDGVHPNII 89