BLASTX nr result
ID: Stemona21_contig00032162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00032162 (1624 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001063970.1| Os09g0568400 [Oryza sativa Japonica Group] g... 64 1e-07 ref|XP_006747426.1| PREDICTED: ubiquitin-60S ribosomal protein L... 61 2e-06 ref|XP_005260109.1| PREDICTED: ubiquitin-60S ribosomal protein L... 60 3e-06 ref|XP_005260107.1| PREDICTED: ubiquitin-60S ribosomal protein L... 60 3e-06 ref|XP_004760991.1| PREDICTED: ubiquitin-60S ribosomal protein L... 60 3e-06 ref|XP_003558419.1| PREDICTED: ubiquitin-60S ribosomal protein L... 59 5e-06 gb|ABK93568.1| unknown [Populus trichocarpa] 59 5e-06 ref|XP_002318470.1| UBIQUITIN EXTENSION protein 1 [Populus trich... 59 5e-06 gb|AAP80631.1|AF475109_1 ubiquitin/ribosomal fusion protein [Tri... 59 5e-06 sp|P51423.2|RL40_BRARP RecName: Full=Ubiquitin-60S ribosomal pro... 59 6e-06 ref|XP_006649690.1| PREDICTED: ubiquitin-60S ribosomal protein L... 59 8e-06 gb|ESW08482.1| hypothetical protein PHAVU_009G049400g [Phaseolus... 59 8e-06 ref|XP_006851447.1| hypothetical protein AMTR_s00040p00104050 [A... 59 8e-06 gb|EOY23660.1| Ubiquitin supergroup,Ribosomal protein L40e [Theo... 59 8e-06 ref|XP_006292019.1| hypothetical protein CARUB_v10018208mg [Caps... 59 8e-06 gb|EMJ03953.1| hypothetical protein PRUPE_ppa013349mg [Prunus pe... 59 8e-06 ref|XP_004156525.1| PREDICTED: ubiquitin-60S ribosomal protein L... 59 8e-06 ref|XP_004137301.1| PREDICTED: ubiquitin-60S ribosomal protein L... 59 8e-06 pdb|3J61|MM Chain m, Localization Of The Large Subunit Ribosomal... 59 8e-06 ref|XP_002530306.1| ubiquitin, putative [Ricinus communis] gi|25... 59 8e-06 >ref|NP_001063970.1| Os09g0568400 [Oryza sativa Japonica Group] gi|113632203|dbj|BAF25884.1| Os09g0568400, partial [Oryza sativa Japonica Group] Length = 44 Score = 64.3 bits (155), Expect = 1e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 87 RSFLCRCYARLHPRAVNCRKKKCGHSNQL 1 R F CRCYARLHPRAVNCRKKKCGHSNQL Sbjct: 8 RLFSCRCYARLHPRAVNCRKKKCGHSNQL 36 >ref|XP_006747426.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X2 [Leptonychotes weddellii] Length = 159 Score = 60.8 bits (146), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 84 SFLCRCYARLHPRAVNCRKKKCGHSNQL 1 S LCRCYARLHPRAVNCRKKKCGH+N L Sbjct: 125 SSLCRCYARLHPRAVNCRKKKCGHTNNL 152 >ref|XP_005260109.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X3 [Homo sapiens] gi|530415150|ref|XP_005260110.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X4 [Homo sapiens] gi|530415152|ref|XP_005260111.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X5 [Homo sapiens] gi|578833561|ref|XP_006722934.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X6 [Homo sapiens] Length = 156 Score = 60.1 bits (144), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 LCRCYARLHPRAVNCRKKKCGHSNQL 1 LCRCYARLHPRAVNCRKKKCGH+N L Sbjct: 124 LCRCYARLHPRAVNCRKKKCGHTNNL 149 >ref|XP_005260107.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X1 [Homo sapiens] Length = 203 Score = 60.1 bits (144), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 LCRCYARLHPRAVNCRKKKCGHSNQL 1 LCRCYARLHPRAVNCRKKKCGH+N L Sbjct: 171 LCRCYARLHPRAVNCRKKKCGHTNNL 196 >ref|XP_004760991.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X2 [Mustela putorius furo] gi|511882213|ref|XP_004760992.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X3 [Mustela putorius furo] gi|511993327|ref|XP_004814311.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X2 [Mustela putorius furo] gi|511993329|ref|XP_004814312.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X3 [Mustela putorius furo] Length = 156 Score = 60.1 bits (144), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 78 LCRCYARLHPRAVNCRKKKCGHSNQL 1 LCRCYARLHPRAVNCRKKKCGH+N L Sbjct: 124 LCRCYARLHPRAVNCRKKKCGHTNNL 149 >ref|XP_003558419.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2-like [Brachypodium distachyon] gi|357160177|ref|XP_003578682.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2-like [Brachypodium distachyon] gi|473890022|gb|EMS48574.1| Ubiquitin-60S ribosomal protein L40-2 [Triticum urartu] Length = 129 Score = 59.3 bits (142), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 90 NQEKMICRKCYARLHPRAVNCRKKKCGHSNQL 121 >gb|ABK93568.1| unknown [Populus trichocarpa] Length = 128 Score = 59.3 bits (142), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 90 NQEKMICRKCYARLHPRAVNCRKKKCGHSNQL 121 >ref|XP_002318470.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa] gi|224135055|ref|XP_002321972.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa] gi|460368318|ref|XP_004230014.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum lycopersicum] gi|460378491|ref|XP_004235004.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum lycopersicum] gi|460398209|ref|XP_004244655.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum lycopersicum] gi|460399867|ref|XP_004245458.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like isoform 1 [Solanum lycopersicum] gi|470135469|ref|XP_004303537.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Fragaria vesca subsp. vesca] gi|470144560|ref|XP_004307922.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Fragaria vesca subsp. vesca] gi|565345340|ref|XP_006339755.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum tuberosum] gi|565353744|ref|XP_006343783.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum tuberosum] gi|565367694|ref|XP_006350492.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum tuberosum] gi|565371230|ref|XP_006352212.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum tuberosum] gi|565403819|ref|XP_006367353.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum tuberosum] gi|566209257|ref|XP_002322818.2| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa] gi|118484077|gb|ABK93924.1| unknown [Populus trichocarpa] gi|118485427|gb|ABK94570.1| unknown [Populus trichocarpa] gi|118488135|gb|ABK95887.1| unknown [Populus trichocarpa] gi|222859143|gb|EEE96690.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa] gi|222868968|gb|EEF06099.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa] gi|321149957|gb|ADW66126.1| ubiquitin extension protein [Solanum nigrum] gi|399920239|gb|AFP55586.1| ubiquitin [Rosa rugosa] gi|550321070|gb|EEF04579.2| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa] Length = 128 Score = 59.3 bits (142), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 90 NQEKMICRKCYARLHPRAVNCRKKKCGHSNQL 121 >gb|AAP80631.1|AF475109_1 ubiquitin/ribosomal fusion protein [Triticum aestivum] Length = 128 Score = 59.3 bits (142), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 89 NQEKMICRKCYARLHPRAVNCRKKKCGHSNQL 120 >sp|P51423.2|RL40_BRARP RecName: Full=Ubiquitin-60S ribosomal protein L40; Contains: RecName: Full=Ubiquitin; Contains: RecName: Full=60S ribosomal protein L40; AltName: Full=CEP52; Flags: Precursor gi|347064|gb|AAA33014.1| ubiquitin/ribosomal protein [Brassica rapa] gi|395079|emb|CAA80863.1| ubiquitin/ribosomal protein [Brassica rapa] Length = 128 Score = 58.9 bits (141), Expect = 6e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 90 NQAKMICRKCYARLHPRAVNCRKKKCGHSNQL 121 >ref|XP_006649690.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2-like isoform X1 [Oryza brachyantha] Length = 208 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 169 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 200 >gb|ESW08482.1| hypothetical protein PHAVU_009G049400g [Phaseolus vulgaris] Length = 128 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 90 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 121 >ref|XP_006851447.1| hypothetical protein AMTR_s00040p00104050 [Amborella trichopoda] gi|548855141|gb|ERN13028.1| hypothetical protein AMTR_s00040p00104050 [Amborella trichopoda] Length = 127 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 89 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 120 >gb|EOY23660.1| Ubiquitin supergroup,Ribosomal protein L40e [Theobroma cacao] Length = 151 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 113 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 144 >ref|XP_006292019.1| hypothetical protein CARUB_v10018208mg [Capsella rubella] gi|482560726|gb|EOA24917.1| hypothetical protein CARUB_v10018208mg [Capsella rubella] Length = 142 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 104 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 135 >gb|EMJ03953.1| hypothetical protein PRUPE_ppa013349mg [Prunus persica] gi|462415058|gb|EMJ19795.1| hypothetical protein PRUPE_ppa013338mg [Prunus persica] Length = 128 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 90 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 121 >ref|XP_004156525.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis sativus] Length = 208 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 170 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 201 >ref|XP_004137301.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis sativus] Length = 93 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 55 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 86 >pdb|3J61|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome Length = 53 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 14 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 45 >ref|XP_002530306.1| ubiquitin, putative [Ricinus communis] gi|255578975|ref|XP_002530340.1| ubiquitin, putative [Ricinus communis] gi|356509194|ref|XP_003523336.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Glycine max] gi|356516113|ref|XP_003526741.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Glycine max] gi|356572584|ref|XP_003554448.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like isoform X1 [Glycine max] gi|449438865|ref|XP_004137208.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis sativus] gi|449456437|ref|XP_004145956.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis sativus] gi|449497417|ref|XP_004160396.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis sativus] gi|565475186|ref|XP_006295234.1| hypothetical protein CARUB_v10024320mg [Capsella rubella] gi|567187366|ref|XP_006403788.1| hypothetical protein EUTSA_v10010818mg [Eutrema salsugineum] gi|567213087|ref|XP_006410789.1| hypothetical protein EUTSA_v10017417mg [Eutrema salsugineum] gi|567875137|ref|XP_006430158.1| hypothetical protein CICLE_v10013083mg [Citrus clementina] gi|567897436|ref|XP_006441206.1| hypothetical protein CICLE_v10022855mg [Citrus clementina] gi|568856344|ref|XP_006481744.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Citrus sinensis] gi|568880532|ref|XP_006493171.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Citrus sinensis] gi|71040673|gb|AAZ20285.1| ubiquitin fusion protein [Arachis hypogaea] gi|147769165|emb|CAN60770.1| hypothetical protein VITISV_012429 [Vitis vinifera] gi|148908659|gb|ABR17437.1| unknown [Picea sitchensis] gi|223530144|gb|EEF32056.1| ubiquitin, putative [Ricinus communis] gi|223530162|gb|EEF32073.1| ubiquitin, putative [Ricinus communis] gi|284433784|gb|ADB85098.1| ubiquitin C variant [Jatropha curcas] gi|297740140|emb|CBI30322.3| unnamed protein product [Vitis vinifera] gi|330318561|gb|AEC10952.1| ubiquitin fusion protein [Camellia sinensis] gi|388516721|gb|AFK46422.1| unknown [Lotus japonicus] gi|482563942|gb|EOA28132.1| hypothetical protein CARUB_v10024320mg [Capsella rubella] gi|508716416|gb|EOY08313.1| Ubiquitin extension protein 1 isoform 1 [Theobroma cacao] gi|557104907|gb|ESQ45241.1| hypothetical protein EUTSA_v10010818mg [Eutrema salsugineum] gi|557111958|gb|ESQ52242.1| hypothetical protein EUTSA_v10017417mg [Eutrema salsugineum] gi|557532215|gb|ESR43398.1| hypothetical protein CICLE_v10013083mg [Citrus clementina] gi|557543468|gb|ESR54446.1| hypothetical protein CICLE_v10022855mg [Citrus clementina] gi|561036386|gb|ESW34916.1| hypothetical protein PHAVU_001G191700g [Phaseolus vulgaris] gi|587850932|gb|EXB41096.1| Ubiquitin-60S ribosomal protein L40 [Morus notabilis] Length = 128 Score = 58.5 bits (140), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -2 Query: 93 NLRSFLCR-CYARLHPRAVNCRKKKCGHSNQL 1 N +CR CYARLHPRAVNCRKKKCGHSNQL Sbjct: 90 NQDKMICRKCYARLHPRAVNCRKKKCGHSNQL 121