BLASTX nr result
ID: Stemona21_contig00031602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00031602 (510 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849950.1| hypothetical protein AMTR_s00022p00137840 [A... 56 4e-06 >ref|XP_006849950.1| hypothetical protein AMTR_s00022p00137840 [Amborella trichopoda] gi|548853548|gb|ERN11531.1| hypothetical protein AMTR_s00022p00137840 [Amborella trichopoda] Length = 116 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 222 SEWRSHSSGRSNSFYAEAIADCLEFIKKSSAPVSGQ*EVSVCL 350 S+ R S GRSNSFYAEAIADCLEFIK+SS+P S +VS CL Sbjct: 68 SDCRPRSFGRSNSFYAEAIADCLEFIKRSSSPES---DVSGCL 107