BLASTX nr result
ID: Stemona21_contig00031396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00031396 (552 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004348537.1| GATA zinc finger domain containing protein [... 57 3e-06 ref|XP_004357578.1| hypothetical protein DFA_02094 [Dictyosteliu... 57 3e-06 >ref|XP_004348537.1| GATA zinc finger domain containing protein [Acanthamoeba castellanii str. Neff] gi|440801054|gb|ELR22079.1| GATA zinc finger domain containing protein [Acanthamoeba castellanii str. Neff] Length = 409 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/46 (58%), Positives = 30/46 (65%), Gaps = 3/46 (6%) Frame = -3 Query: 364 PRLMQGRLFCRWCGVTKTPLWRNGPDGSETLCNNCGL---SFLRGE 236 PR+M GR C CG+T TP WR GPDG TLCN CGL F+R E Sbjct: 294 PRVMTGRT-CMHCGITSTPEWRTGPDGKGTLCNACGLRYRKFVRAE 338 >ref|XP_004357578.1| hypothetical protein DFA_02094 [Dictyostelium fasciculatum] gi|328870935|gb|EGG19307.1| hypothetical protein DFA_02094 [Dictyostelium fasciculatum] Length = 1203 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = -3 Query: 346 RLFCRWCGVTKTPLWRNGPDGSETLCNNCGLSFLRGER 233 +LFC CG+T+TP WR GP+G +LCN CGL++ + ER Sbjct: 1006 KLFCHQCGITQTPEWRRGPNGPASLCNACGLNYAKKER 1043