BLASTX nr result
ID: Stemona21_contig00031240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00031240 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516859.1| hypothetical protein GlmaxMp10 (mitochondrio... 55 1e-05 >ref|YP_007516859.1| hypothetical protein GlmaxMp10 (mitochondrion) [Glycine max] gi|403311588|gb|AFR34336.1| hypothetical protein GlmaxMp10 (mitochondrion) [Glycine max] Length = 129 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/69 (46%), Positives = 42/69 (60%) Frame = -1 Query: 460 HLAFCVVSISRRLLVMRRPLPILGTIVANKYGDGFFAKLLTLTDNN*IEQRTRKLMDQIR 281 +LAF VSI++R +++R+ LPIL I+A KY DG + KLL TR +M I Sbjct: 41 YLAFSAVSINKRNIIIRKTLPILNRILATKYVDGLYEKLL-----------TRNIMLPIW 89 Query: 280 KEHERGIER 254 KE RGIER Sbjct: 90 KEDARGIER 98