BLASTX nr result
ID: Stemona21_contig00030842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00030842 (436 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828856.1| hypothetical protein AMTR_s00001p00162400 [A... 56 6e-06 >ref|XP_006828856.1| hypothetical protein AMTR_s00001p00162400 [Amborella trichopoda] gi|548833835|gb|ERM96272.1| hypothetical protein AMTR_s00001p00162400 [Amborella trichopoda] Length = 331 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/65 (44%), Positives = 41/65 (63%) Frame = +2 Query: 233 RSVNWDGTGDDDSDQFLHASLLVPETIRHYKLWKRGFVEDTVWQSPARIHPSFVPAEGVK 412 R+ NWD D+ ++++ AS+L ETIRHY+L K+GF E T W S +R+ PS E Sbjct: 74 RTENWD----DEDNEYIEASVLTSETIRHYQLHKQGFSEMTPWHSSSRLLPSSASKEDQV 129 Query: 413 SDVSS 427 + VSS Sbjct: 130 NLVSS 134