BLASTX nr result
ID: Stemona21_contig00029483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00029483 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ12183.1| hypothetical protein PRUPE_ppa021532mg [Prunus pe... 93 3e-17 ref|XP_006440836.1| hypothetical protein CICLE_v10018700mg [Citr... 92 5e-17 ref|XP_006485726.1| PREDICTED: pentatricopeptide repeat-containi... 92 7e-17 ref|XP_004301089.1| PREDICTED: pentatricopeptide repeat-containi... 92 7e-17 ref|XP_006345330.1| PREDICTED: pentatricopeptide repeat-containi... 92 9e-17 ref|XP_004516865.1| PREDICTED: pentatricopeptide repeat-containi... 92 9e-17 ref|XP_004242943.1| PREDICTED: pentatricopeptide repeat-containi... 92 9e-17 gb|ESW10380.1| hypothetical protein PHAVU_009G204200g [Phaseolus... 91 2e-16 ref|XP_006451427.1| hypothetical protein CICLE_v10008172mg [Citr... 91 2e-16 gb|EOY30508.1| Tetratricopeptide repeat-like superfamily protein... 91 2e-16 gb|EOX98248.1| Tetratricopeptide repeat-like superfamily protein... 91 2e-16 ref|XP_003565175.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_003528249.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_002322051.2| pentatricopeptide repeat-containing family p... 90 3e-16 gb|EXB93974.1| hypothetical protein L484_015521 [Morus notabilis] 90 3e-16 ref|XP_006650653.1| PREDICTED: pentatricopeptide repeat-containi... 90 3e-16 gb|EMT03776.1| hypothetical protein F775_09022 [Aegilops tauschii] 90 3e-16 gb|AFW67506.1| pentatricopeptide repeat (PPR) superfamily protei... 90 3e-16 ref|XP_003595674.1| Pentatricopeptide repeat protein [Medicago t... 90 3e-16 ref|XP_002463828.1| hypothetical protein SORBIDRAFT_01g006970 [S... 90 3e-16 >gb|EMJ12183.1| hypothetical protein PRUPE_ppa021532mg [Prunus persica] Length = 840 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -1 Query: 469 CKNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 CKN+RIC DCHNA KL+SKVV REIVVRDNKRFHHF+ GLCSC DYW Sbjct: 794 CKNLRICVDCHNAAKLISKVVEREIVVRDNKRFHHFKHGLCSCGDYW 840 >ref|XP_006440836.1| hypothetical protein CICLE_v10018700mg [Citrus clementina] gi|557543098|gb|ESR54076.1| hypothetical protein CICLE_v10018700mg [Citrus clementina] Length = 980 Score = 92.4 bits (228), Expect = 5e-17 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -1 Query: 469 CKNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 CKN+RIC DCHNA KL+SKV REIVVRDNKRFHHFR+G+CSC DYW Sbjct: 934 CKNLRICVDCHNAAKLISKVAEREIVVRDNKRFHHFRDGVCSCGDYW 980 >ref|XP_006485726.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Citrus sinensis] Length = 980 Score = 92.0 bits (227), Expect = 7e-17 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 469 CKNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 CKN+RIC DCHNA KL+SKV REIV+RDNKRFHHFR+G+CSC DYW Sbjct: 934 CKNLRICVDCHNAAKLISKVAEREIVIRDNKRFHHFRDGVCSCGDYW 980 >ref|XP_004301089.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Fragaria vesca subsp. vesca] Length = 957 Score = 92.0 bits (227), Expect = 7e-17 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 469 CKNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 CKN+RIC DCHNA KL+SK V REI+VRDNKRFHHF++GLCSC DYW Sbjct: 911 CKNLRICLDCHNAAKLISKAVEREIIVRDNKRFHHFKDGLCSCGDYW 957 >ref|XP_006345330.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Solanum tuberosum] Length = 466 Score = 91.7 bits (226), Expect = 9e-17 Identities = 35/46 (76%), Positives = 44/46 (95%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+RIC DCHNA+K++SK+VGRE++VRDNKRFHHFR+G CSC+DYW Sbjct: 421 KNLRICGDCHNAIKIMSKIVGRELIVRDNKRFHHFRDGKCSCNDYW 466 >ref|XP_004516865.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Cicer arietinum] Length = 988 Score = 91.7 bits (226), Expect = 9e-17 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 469 CKNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 CKN+RIC DCHNA+KLVSKV REI+VRDNKRFHHF++G CSC DYW Sbjct: 942 CKNLRICVDCHNAIKLVSKVAKREIIVRDNKRFHHFKKGFCSCGDYW 988 >ref|XP_004242943.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Solanum lycopersicum] Length = 466 Score = 91.7 bits (226), Expect = 9e-17 Identities = 35/46 (76%), Positives = 44/46 (95%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+RIC DCHNA+K++SK+VGRE++VRDNKRFHHFR+G CSC+DYW Sbjct: 421 KNLRICGDCHNAIKIMSKIVGRELIVRDNKRFHHFRDGKCSCNDYW 466 >gb|ESW10380.1| hypothetical protein PHAVU_009G204200g [Phaseolus vulgaris] Length = 982 Score = 90.9 bits (224), Expect = 2e-16 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -1 Query: 469 CKNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 CKN+RIC DCHNA+KLVSKVV R+IVVRDNKRFHHF+ G C+C DYW Sbjct: 936 CKNLRICVDCHNAIKLVSKVVERDIVVRDNKRFHHFKNGFCTCGDYW 982 >ref|XP_006451427.1| hypothetical protein CICLE_v10008172mg [Citrus clementina] gi|568842990|ref|XP_006475408.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Citrus sinensis] gi|557554653|gb|ESR64667.1| hypothetical protein CICLE_v10008172mg [Citrus clementina] Length = 475 Score = 90.5 bits (223), Expect = 2e-16 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+RIC DCHNA+K++SK+VGRE++VRDNKRFHHFR+G CSC DYW Sbjct: 430 KNLRICGDCHNAIKIMSKIVGRELIVRDNKRFHHFRDGKCSCGDYW 475 >gb|EOY30508.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 485 Score = 90.5 bits (223), Expect = 2e-16 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+RIC DCHNA+K++SK+VGRE++VRDNKRFHHFR+G CSC DYW Sbjct: 440 KNLRICGDCHNAIKIMSKIVGRELIVRDNKRFHHFRDGKCSCGDYW 485 >gb|EOX98248.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 613 Score = 90.5 bits (223), Expect = 2e-16 Identities = 32/46 (69%), Positives = 44/46 (95%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+R+C DCHNA+K++S++VGRE+++RDNKRFHHF++GLCSC DYW Sbjct: 568 KNLRVCGDCHNAIKIISRIVGRELIIRDNKRFHHFKDGLCSCGDYW 613 >ref|XP_003565175.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Brachypodium distachyon] Length = 849 Score = 90.5 bits (223), Expect = 2e-16 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KNIR+CKDCHNA KL+SKV REIVVRD KRFHHFR+GLCSC DYW Sbjct: 804 KNIRMCKDCHNAAKLISKVADREIVVRDKKRFHHFRDGLCSCGDYW 849 >ref|XP_003528249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Glycine max] Length = 975 Score = 90.5 bits (223), Expect = 2e-16 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -1 Query: 469 CKNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 CKN+RIC DCHNA+KLVSKVV R+I+VRDNKRFHHF+ GLC+C D+W Sbjct: 929 CKNLRICVDCHNAIKLVSKVVKRDIIVRDNKRFHHFKNGLCTCGDFW 975 >ref|XP_002322051.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550321866|gb|EEF06178.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 837 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+RIC DCHNA KL+SK V REIVVRDNKRFHHFR+GLCSC DYW Sbjct: 792 KNLRICADCHNAAKLISKAVEREIVVRDNKRFHHFRDGLCSCCDYW 837 >gb|EXB93974.1| hypothetical protein L484_015521 [Morus notabilis] Length = 719 Score = 89.7 bits (221), Expect = 3e-16 Identities = 34/46 (73%), Positives = 43/46 (93%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+R+C DCHNALK+VSK+VGRE+++RD KRFHHF++GLCSC DYW Sbjct: 674 KNLRVCGDCHNALKIVSKIVGRELIMRDAKRFHHFKDGLCSCRDYW 719 >ref|XP_006650653.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Oryza brachyantha] Length = 297 Score = 89.7 bits (221), Expect = 3e-16 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+RIC DCHNA+KL++KV GREIVVRDNKRFHHF++G CSC DYW Sbjct: 252 KNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSCGDYW 297 >gb|EMT03776.1| hypothetical protein F775_09022 [Aegilops tauschii] Length = 638 Score = 89.7 bits (221), Expect = 3e-16 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KNIR+CKDCHNA +L+SKV GREIVVRD KRFHHFR G+CSC DYW Sbjct: 593 KNIRMCKDCHNAARLISKVTGREIVVRDKKRFHHFRGGICSCGDYW 638 >gb|AFW67506.1| pentatricopeptide repeat (PPR) superfamily protein [Zea mays] Length = 304 Score = 89.7 bits (221), Expect = 3e-16 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+RIC DCHNA+KL++KV GREIVVRDNKRFHHF++G CSC DYW Sbjct: 259 KNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSCGDYW 304 >ref|XP_003595674.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355484722|gb|AES65925.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 975 Score = 89.7 bits (221), Expect = 3e-16 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -1 Query: 469 CKNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 CKN+RIC DCHNA+KLVSK+ REI+VRDNKRFHHF+ G CSC DYW Sbjct: 929 CKNLRICVDCHNAIKLVSKIDKREIIVRDNKRFHHFKNGFCSCGDYW 975 >ref|XP_002463828.1| hypothetical protein SORBIDRAFT_01g006970 [Sorghum bicolor] gi|241917682|gb|EER90826.1| hypothetical protein SORBIDRAFT_01g006970 [Sorghum bicolor] Length = 304 Score = 89.7 bits (221), Expect = 3e-16 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 466 KNIRICKDCHNALKLVSKVVGREIVVRDNKRFHHFREGLCSCHDYW 329 KN+RIC DCHNA+KL++KV GREIVVRDNKRFHHF++G CSC DYW Sbjct: 259 KNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSCGDYW 304