BLASTX nr result
ID: Stemona21_contig00026955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00026955 (276 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006417759.1| hypothetical protein EUTSA_v10007281mg [Eutr... 57 2e-06 ref|XP_006303625.1| hypothetical protein CARUB_v10011500mg [Caps... 57 3e-06 ref|NP_172263.4| uncharacterized protein [Arabidopsis thaliana] ... 57 3e-06 ref|XP_002314204.1| hypothetical protein POPTR_0009s03140g [Popu... 57 3e-06 gb|EOY34243.1| Uncharacterized protein TCM_041982 [Theobroma cacao] 55 7e-06 >ref|XP_006417759.1| hypothetical protein EUTSA_v10007281mg [Eutrema salsugineum] gi|557095530|gb|ESQ36112.1| hypothetical protein EUTSA_v10007281mg [Eutrema salsugineum] Length = 548 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 1 PRRDCCRVLPSSRGSTMHISVGNCRDGEFSEL 96 PRRDCCRVLPS R +TM+I VGNC DGE SEL Sbjct: 512 PRRDCCRVLPSRRNTTMYIWVGNCADGEISEL 543 >ref|XP_006303625.1| hypothetical protein CARUB_v10011500mg [Capsella rubella] gi|482572336|gb|EOA36523.1| hypothetical protein CARUB_v10011500mg [Capsella rubella] Length = 541 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 1 PRRDCCRVLPSSRGSTMHISVGNCRDGEFSEL 96 PRRDCCRVLPS R TM+I VGNC DGE SEL Sbjct: 505 PRRDCCRVLPSRRNKTMYIWVGNCADGEISEL 536 >ref|NP_172263.4| uncharacterized protein [Arabidopsis thaliana] gi|332190072|gb|AEE28193.1| uncharacterized protein AT1G07850 [Arabidopsis thaliana] Length = 541 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +1 Query: 1 PRRDCCRVLPSSRGSTMHISVGNCRDGEFSEL 96 PRRDCCRVLPS R TM+I VGNC DGE SEL Sbjct: 504 PRRDCCRVLPSRRNQTMYIWVGNCADGEISEL 535 >ref|XP_002314204.1| hypothetical protein POPTR_0009s03140g [Populus trichocarpa] gi|222850612|gb|EEE88159.1| hypothetical protein POPTR_0009s03140g [Populus trichocarpa] Length = 499 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 1 PRRDCCRVLPSSRGSTMHISVGNCRDGEFSE 93 PRRDCCRVLP+++ STM++ VGNCRDGE SE Sbjct: 465 PRRDCCRVLPTNKASTMYLWVGNCRDGEISE 495 >gb|EOY34243.1| Uncharacterized protein TCM_041982 [Theobroma cacao] Length = 511 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 1 PRRDCCRVLPSSRGSTMHISVGNCRDGEFSEL 96 PRRDCCRVLPS + +TM +SVGNCR+GE +EL Sbjct: 473 PRRDCCRVLPSRKNNTMVLSVGNCREGEVNEL 504