BLASTX nr result
ID: Stemona21_contig00026923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00026923 (369 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280924.1| PREDICTED: ethylene-responsive transcription... 55 1e-05 emb|CAN73076.1| hypothetical protein VITISV_032388 [Vitis vinifera] 55 1e-05 >ref|XP_002280924.1| PREDICTED: ethylene-responsive transcription factor ERF114-like [Vitis vinifera] Length = 315 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -3 Query: 319 KVDRRHGKRPSAPYQPEKKKEEDHIIFSRYAAERAHQDTSAMISALTHVI 170 KVDRRHGKRP + E+K+++DH IF Y+A R+ QD SAM+SALT VI Sbjct: 34 KVDRRHGKRPLPSDEAEEKEDQDH-IFPVYSA-RSQQDMSAMVSALTQVI 81 >emb|CAN73076.1| hypothetical protein VITISV_032388 [Vitis vinifera] Length = 304 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -3 Query: 319 KVDRRHGKRPSAPYQPEKKKEEDHIIFSRYAAERAHQDTSAMISALTHVI 170 KVDRRHGKRP + E+K+++DH IF Y+A R+ QD SAM+SALT VI Sbjct: 41 KVDRRHGKRPLPSDEAEEKEDQDH-IFPVYSA-RSQQDMSAMVSALTQVI 88