BLASTX nr result
ID: Stemona21_contig00026771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00026771 (289 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB35142.1| small heat shock protein [Musa acuminata AAA Group] 62 1e-07 ref|XP_004307593.1| PREDICTED: 17.5 kDa class I heat shock prote... 60 4e-07 gb|ADQ08649.1| class I cytosolic small heat shock protein [Poten... 58 1e-06 gb|AAL32036.1|AF439277_1 small heat shock protein [Retama raetam] 57 3e-06 >gb|AFB35142.1| small heat shock protein [Musa acuminata AAA Group] Length = 156 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 8/50 (16%) Frame = +3 Query: 162 MSIVRRSNVFDPFSLDVWDPF--FP------IADFRPAFASETAAVANTR 287 MSIVRRSN+FDPFSLDV+DPF FP +A+ RP F SET+A ANTR Sbjct: 1 MSIVRRSNIFDPFSLDVFDPFQGFPFDAFRSLAETRPGFVSETSAFANTR 50 >ref|XP_004307593.1| PREDICTED: 17.5 kDa class I heat shock protein-like [Fragaria vesca subsp. vesca] Length = 158 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/40 (72%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = +3 Query: 174 RRSNVFDPFSLDVWDPF--FPIADFRPAFASETAAVANTR 287 RRSN+FDPFSLD+WDPF FP+ R A SETAAVANTR Sbjct: 13 RRSNIFDPFSLDIWDPFQDFPLTTSRSAPRSETAAVANTR 52 >gb|ADQ08649.1| class I cytosolic small heat shock protein [Potentilla discolor] Length = 158 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = +3 Query: 174 RRSNVFDPFSLDVWDPF--FPIADFRPAFASETAAVANTR 287 RRSN+ DPFSLD+WDPF FP+ + R A SETAAVANTR Sbjct: 13 RRSNILDPFSLDIWDPFQDFPLINSRSAPRSETAAVANTR 52 >gb|AAL32036.1|AF439277_1 small heat shock protein [Retama raetam] Length = 158 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 3/41 (7%) Frame = +3 Query: 174 RRSNVFDPFSLDVWDPF--FPIADFRPA-FASETAAVANTR 287 RR+NVFDPFSLD+WDPF FP+ P+ F +ETAAVANTR Sbjct: 12 RRTNVFDPFSLDIWDPFQDFPLRTIAPSGFDTETAAVANTR 52