BLASTX nr result
ID: Stemona21_contig00025992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00025992 (869 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828094.1| hypothetical protein AMTR_s00151p00074930 [A... 52 1e-05 >ref|XP_006828094.1| hypothetical protein AMTR_s00151p00074930 [Amborella trichopoda] gi|548832740|gb|ERM95510.1| hypothetical protein AMTR_s00151p00074930 [Amborella trichopoda] Length = 160 Score = 51.6 bits (122), Expect(2) = 1e-05 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = -3 Query: 867 SRCGTTGPGEDNXXXXXXXLRFGDGGPTVGNSRHKHL 757 S C TTGPGE+N LRFGDGGPTV NSRHK L Sbjct: 101 SSCETTGPGEENQLFLVLCLRFGDGGPTVCNSRHKAL 137 Score = 25.0 bits (53), Expect(2) = 1e-05 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 760 LDRRGPALLLL 728 LDRRGPALLLL Sbjct: 137 LDRRGPALLLL 147