BLASTX nr result
ID: Stemona21_contig00025661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00025661 (747 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomen... 58 4e-06 emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum] 58 4e-06 >ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomentosiformis] gi|80750905|dbj|BAE47981.1| hypothetical protein [Nicotiana tomentosiformis] Length = 90 Score = 57.8 bits (138), Expect = 4e-06 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = +3 Query: 543 KIKRKKFLQIRIKS*AIEESGEREIRTLGTNNSYNGLAIRRFSPLSHLSN*K 698 K K K F ++ K+ I +G+R IRTLGT NSYNGLAIRRFSPLSHLS K Sbjct: 36 KNKNKGFRNLKKKNQVI--NGKRGIRTLGTINSYNGLAIRRFSPLSHLSQLK 85 >emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum] Length = 90 Score = 57.8 bits (138), Expect = 4e-06 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = +3 Query: 543 KIKRKKFLQIRIKS*AIEESGEREIRTLGTNNSYNGLAIRRFSPLSHLSN*K 698 K K K F ++ K+ I +G+R IRTLGT NSYNGLAIRRFSPLSHLS K Sbjct: 36 KNKNKGFRNLKKKNQVI--NGKRGIRTLGTINSYNGLAIRRFSPLSHLSQLK 85