BLASTX nr result
ID: Stemona21_contig00024766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00024766 (293 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ16234.1| hypothetical protein PRUPE_ppa011970mg [Prunus pe... 84 2e-14 ref|XP_002283949.1| PREDICTED: histone chaperone ASF1B [Vitis vi... 82 7e-14 gb|ESW09323.1| hypothetical protein PHAVU_009G1181001g, partial ... 80 2e-13 ref|XP_006448324.1| hypothetical protein CICLE_v10016840mg [Citr... 80 2e-13 ref|XP_006448323.1| hypothetical protein CICLE_v10016840mg [Citr... 80 2e-13 ref|XP_004150672.1| PREDICTED: histone chaperone ASF1B-like [Cuc... 80 2e-13 ref|XP_006843956.1| hypothetical protein AMTR_s00006p00077230 [A... 80 3e-13 ref|XP_002266119.1| PREDICTED: histone chaperone ASF1B [Vitis vi... 80 4e-13 gb|EOY04063.1| Histone chaperone ASF1A [Theobroma cacao] 79 6e-13 gb|EXB65594.1| Histone chaperone ASF1B [Morus notabilis] 78 1e-12 ref|XP_006580923.1| PREDICTED: uncharacterized protein LOC100305... 78 1e-12 ref|NP_001235672.1| uncharacterized protein LOC100305970 [Glycin... 78 1e-12 ref|XP_004961298.1| PREDICTED: histone chaperone ASF1B-like [Set... 77 2e-12 gb|AFK45392.1| unknown [Lotus japonicus] 77 2e-12 ref|XP_003522389.1| PREDICTED: histone chaperone ASF1B-like [Gly... 77 2e-12 gb|ABK25264.1| unknown [Picea sitchensis] 77 3e-12 ref|XP_002440209.1| hypothetical protein SORBIDRAFT_09g027820 [S... 76 4e-12 gb|ACN27919.1| unknown [Zea mays] gi|413946414|gb|AFW79063.1| an... 76 4e-12 ref|XP_006430692.1| hypothetical protein CICLE_v10012845mg [Citr... 76 5e-12 ref|NP_001150107.1| LOC100283736 [Zea mays] gi|195636800|gb|ACG3... 76 5e-12 >gb|EMJ16234.1| hypothetical protein PRUPE_ppa011970mg [Prunus persica] Length = 189 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAP 131 EEPPPKVLIDRVQRNIL+DKPRVTKFPINFHPE +NG QPAP Sbjct: 124 EEPPPKVLIDRVQRNILSDKPRVTKFPINFHPENTENGEQPAP 166 >ref|XP_002283949.1| PREDICTED: histone chaperone ASF1B [Vitis vinifera] gi|147809982|emb|CAN60547.1| hypothetical protein VITISV_031470 [Vitis vinifera] gi|297737738|emb|CBI26939.3| unnamed protein product [Vitis vinifera] Length = 186 Score = 82.0 bits (201), Expect = 7e-14 Identities = 40/54 (74%), Positives = 44/54 (81%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSPQNDTNNE 164 EEPP KVLIDRVQRNILADKPRVTKFPINFHPE ++G QP PSP+ + N E Sbjct: 124 EEPPQKVLIDRVQRNILADKPRVTKFPINFHPENNEHGEQPP--PSPEINENGE 175 >gb|ESW09323.1| hypothetical protein PHAVU_009G1181001g, partial [Phaseolus vulgaris] Length = 154 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSP 143 EEPPPKVL+DRVQRNIL+DKPRVTKFPINFHPE +N QP P P Sbjct: 87 EEPPPKVLVDRVQRNILSDKPRVTKFPINFHPENNENEEQPPPSEHP 133 >ref|XP_006448324.1| hypothetical protein CICLE_v10016840mg [Citrus clementina] gi|568828951|ref|XP_006468797.1| PREDICTED: probable histone chaperone ASF1A-like isoform X1 [Citrus sinensis] gi|557550935|gb|ESR61564.1| hypothetical protein CICLE_v10016840mg [Citrus clementina] Length = 190 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSPQNDTNNE 164 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPE ++G P + + + N E Sbjct: 124 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPENNEHGEDSPPDQATETNENGE 177 >ref|XP_006448323.1| hypothetical protein CICLE_v10016840mg [Citrus clementina] gi|568828953|ref|XP_006468798.1| PREDICTED: probable histone chaperone ASF1A-like isoform X2 [Citrus sinensis] gi|568828955|ref|XP_006468799.1| PREDICTED: probable histone chaperone ASF1A-like isoform X3 [Citrus sinensis] gi|557550934|gb|ESR61563.1| hypothetical protein CICLE_v10016840mg [Citrus clementina] Length = 172 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSPQNDTNNE 164 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPE ++G P + + + N E Sbjct: 106 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPENNEHGEDSPPDQATETNENGE 159 >ref|XP_004150672.1| PREDICTED: histone chaperone ASF1B-like [Cucumis sativus] gi|449519400|ref|XP_004166723.1| PREDICTED: histone chaperone ASF1B-like [Cucumis sativus] Length = 212 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/57 (71%), Positives = 45/57 (78%), Gaps = 3/57 (5%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSPQNDT---NNE 164 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPE ++GA+ P SP + NNE Sbjct: 124 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPENSEHGAEQQP-SSPHHSVEALNNE 179 >ref|XP_006843956.1| hypothetical protein AMTR_s00006p00077230 [Amborella trichopoda] gi|548846355|gb|ERN05631.1| hypothetical protein AMTR_s00006p00077230 [Amborella trichopoda] Length = 189 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSPQND 152 EEPPP+VLIDRVQRNILADKPRVTKFPINFHPE+ D+ P P P ++ Sbjct: 124 EEPPPRVLIDRVQRNILADKPRVTKFPINFHPESADSTDAPPPSSPPSSE 173 >ref|XP_002266119.1| PREDICTED: histone chaperone ASF1B [Vitis vinifera] gi|296087223|emb|CBI33597.3| unnamed protein product [Vitis vinifera] Length = 193 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/55 (72%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSP-QNDTNNE 164 EEPP KVLIDRVQRNIL+DKPRVTKFPINFHPE D G QP P P + D N E Sbjct: 124 EEPPQKVLIDRVQRNILSDKPRVTKFPINFHPENKDPGDQPPPPDHPAETDGNRE 178 >gb|EOY04063.1| Histone chaperone ASF1A [Theobroma cacao] Length = 191 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/55 (70%), Positives = 44/55 (80%), Gaps = 1/55 (1%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSP-QNDTNNE 164 EEPPPKVLI++VQRNIL+DKPRVTKFPINFHPE G N +P P P +ND N E Sbjct: 124 EEPPPKVLIEKVQRNILSDKPRVTKFPINFHPENGGN-EEPPPADHPGENDGNEE 177 >gb|EXB65594.1| Histone chaperone ASF1B [Morus notabilis] Length = 206 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIP 137 EEPP KVLIDRVQRNILADKPRVTKFPINFHPE ++ QP P P Sbjct: 124 EEPPTKVLIDRVQRNILADKPRVTKFPINFHPENNEHEEQPPPSP 168 >ref|XP_006580923.1| PREDICTED: uncharacterized protein LOC100305970 isoform X1 [Glycine max] Length = 192 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSPQNDTNNE 164 EEPPPKVLIDRVQRNIL+DKPRVTKFPINFHPE +N Q P ++T + Sbjct: 124 EEPPPKVLIDRVQRNILSDKPRVTKFPINFHPENNENEEQQPPPSEHPSETGED 177 >ref|NP_001235672.1| uncharacterized protein LOC100305970 [Glycine max] gi|255627147|gb|ACU13918.1| unknown [Glycine max] Length = 192 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/54 (66%), Positives = 41/54 (75%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSPQNDTNNE 164 EEPPPKVLIDRVQRNIL+DKPRVTKFPINFHPE +N Q P ++T + Sbjct: 124 EEPPPKVLIDRVQRNILSDKPRVTKFPINFHPENNENEEQQPPPSEHPSETGED 177 >ref|XP_004961298.1| PREDICTED: histone chaperone ASF1B-like [Setaria italica] Length = 189 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/56 (69%), Positives = 41/56 (73%), Gaps = 3/56 (5%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIP---SPQNDTNN 161 EEPP KVLIDRVQRNILADKPRVTKFPINFHPE + Q P SP+N T N Sbjct: 124 EEPPAKVLIDRVQRNILADKPRVTKFPINFHPEPSTSAGQQQQEPQTASPENHTGN 179 >gb|AFK45392.1| unknown [Lotus japonicus] Length = 205 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/50 (74%), Positives = 40/50 (80%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSPQND 152 EEPPPKVL+D+VQRNIL+DKPRVTKFPINFHPE N QP PQND Sbjct: 124 EEPPPKVLVDKVQRNILSDKPRVTKFPINFHPENNVNEEQP-----PQND 168 >ref|XP_003522389.1| PREDICTED: histone chaperone ASF1B-like [Glycine max] Length = 191 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/47 (76%), Positives = 38/47 (80%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSP 143 EEPPPKVLIDRVQRNIL+DKPRVTKFPINFHPE +N Q P P Sbjct: 124 EEPPPKVLIDRVQRNILSDKPRVTKFPINFHPENNENEEQLPPSEHP 170 >gb|ABK25264.1| unknown [Picea sitchensis] Length = 172 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/47 (76%), Positives = 37/47 (78%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIPSP 143 EEPPP+VLIDRVQRNILADKPRVTKFPINFHP PAP P P Sbjct: 124 EEPPPRVLIDRVQRNILADKPRVTKFPINFHPATIGPPENPAPPPDP 170 >ref|XP_002440209.1| hypothetical protein SORBIDRAFT_09g027820 [Sorghum bicolor] gi|241945494|gb|EES18639.1| hypothetical protein SORBIDRAFT_09g027820 [Sorghum bicolor] Length = 193 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/56 (69%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIP---SPQNDTNN 161 EEPP KVLIDRVQRNILADKPRVTKFPINFHPE Q P SP+N T N Sbjct: 124 EEPPAKVLIDRVQRNILADKPRVTKFPINFHPEPSTGTGQQQQEPQAASPENHTGN 179 >gb|ACN27919.1| unknown [Zea mays] gi|413946414|gb|AFW79063.1| anti-silencing protein 1 [Zea mays] Length = 191 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/56 (69%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIP---SPQNDTNN 161 EEPP KVLIDRVQRNILADKPRVTKFPINFHPE Q P SP+N T N Sbjct: 124 EEPPAKVLIDRVQRNILADKPRVTKFPINFHPEPSTGPGQQQQEPQTTSPENHTGN 179 >ref|XP_006430692.1| hypothetical protein CICLE_v10012845mg [Citrus clementina] gi|557532749|gb|ESR43932.1| hypothetical protein CICLE_v10012845mg [Citrus clementina] Length = 194 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPEAGDNGAQPAPIP 137 EEPP KVLID VQRNIL+DKPRVTKFPINFHPE ++G +P P P Sbjct: 124 EEPPQKVLIDTVQRNILSDKPRVTKFPINFHPEHAESGEEPPPPP 168 >ref|NP_001150107.1| LOC100283736 [Zea mays] gi|195636800|gb|ACG37868.1| anti-silencing protein 1 [Zea mays] Length = 192 Score = 75.9 bits (185), Expect = 5e-12 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 4/57 (7%) Frame = +3 Query: 3 EEPPPKVLIDRVQRNILADKPRVTKFPINFHPE----AGDNGAQPAPIPSPQNDTNN 161 EEPP KVLIDRVQRNILADKPRVTKFPINFHPE G Q SP+N T N Sbjct: 124 EEPPAKVLIDRVQRNILADKPRVTKFPINFHPEPSTGPGQQQQQEPQTTSPENHTGN 180