BLASTX nr result
ID: Stemona21_contig00023693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00023693 (254 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW59117.1| putative RING zinc finger domain superfamily prot... 59 9e-07 >gb|AFW59117.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 187 Score = 58.5 bits (140), Expect = 9e-07 Identities = 40/84 (47%), Positives = 47/84 (55%), Gaps = 10/84 (11%) Frame = -1 Query: 224 MGFPVGYSEXXXXXXXXXXXL--GDVRRLVSKAFVAVGLGDLLDT----DVPSDPPARRQ 63 MGFP GYSE L G VRR + AF AVGLGDLLD P P R+ Sbjct: 1 MGFPAGYSELVLPKQLLHLLLLLGYVRRFLLWAFDAVGLGDLLDLGDDHQAPQPQPQHRR 60 Query: 62 SQQRAAL----VEEALPVVRFEEL 3 ++ RAA+ +EEALPV RF+EL Sbjct: 61 AEFRAAMPAMVIEEALPVARFDEL 84