BLASTX nr result
ID: Stemona21_contig00023057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00023057 (341 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844951.1| hypothetical protein AMTR_s00058p00168420 [A... 56 6e-06 >ref|XP_006844951.1| hypothetical protein AMTR_s00058p00168420 [Amborella trichopoda] gi|548847442|gb|ERN06626.1| hypothetical protein AMTR_s00058p00168420 [Amborella trichopoda] Length = 563 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/97 (31%), Positives = 57/97 (58%) Frame = -3 Query: 321 DPVSKLPDSEIQEQIQRLLKQITSGIMSKLKDGGEKLRSLLRKRQEELDSRKLVHSKKGA 142 + V K+ D +++E+IQR+ + +++ KL DGGEK R+ L++ ++E + RK+ KK A Sbjct: 59 EKVEKITDHQLEEKIQRVKRTLSTSFTLKLPDGGEKFRTSLKRLEDEKERRKIQRLKKEA 118 Query: 141 GDCATFKQSKTKDSTDSYVNSSLGFITSKSHSKSSNG 31 + + K + D++++ TS S S SS+G Sbjct: 119 DE--SEKSKRNSIFLDAFLDHRSQPSTSLSQSMSSSG 153