BLASTX nr result
ID: Stemona21_contig00022883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00022883 (293 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY31825.1| X-ray repair cross complementing 3 (XRCC3) isofor... 55 1e-05 >gb|EOY31825.1| X-ray repair cross complementing 3 (XRCC3) isoform 1 [Theobroma cacao] gi|508784570|gb|EOY31826.1| X-ray repair cross complementing 3 (XRCC3) isoform 1 [Theobroma cacao] gi|508784571|gb|EOY31827.1| X-ray repair cross complementing 3 (XRCC3) isoform 1 [Theobroma cacao] gi|508784572|gb|EOY31828.1| X-ray repair cross complementing 3 (XRCC3) isoform 1 [Theobroma cacao] gi|508784573|gb|EOY31829.1| X-ray repair cross complementing 3 (XRCC3) isoform 1 [Theobroma cacao] Length = 299 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 290 KTRRRMEVVFAPHLPESSCEFTITAEGVFGV 198 +TRR++ VVFAPHLPESSCEF IT EG+FGV Sbjct: 264 QTRRKLYVVFAPHLPESSCEFVITREGLFGV 294