BLASTX nr result
ID: Stemona21_contig00022876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00022876 (377 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006430173.1| hypothetical protein CICLE_v10011946mg [Citr... 58 1e-06 ref|XP_006430170.1| hypothetical protein CICLE_v10011946mg [Citr... 58 1e-06 ref|XP_006430169.1| hypothetical protein CICLE_v10011946mg [Citr... 58 1e-06 ref|XP_002322823.2| hypothetical protein POPTR_0016s07920g [Popu... 55 7e-06 >ref|XP_006430173.1| hypothetical protein CICLE_v10011946mg [Citrus clementina] gi|557532230|gb|ESR43413.1| hypothetical protein CICLE_v10011946mg [Citrus clementina] Length = 362 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 200 ASNIVVEAVDNSEKFTTNWQFGLFELHNSHYAAVCMETGDSIGG 69 AS IVVE+ D+ E T+NWQF L +L SHYAA+CME +S GG Sbjct: 281 ASEIVVESSDDPENLTSNWQFALLDLAGSHYAAICMEKENSAGG 324 >ref|XP_006430170.1| hypothetical protein CICLE_v10011946mg [Citrus clementina] gi|557532227|gb|ESR43410.1| hypothetical protein CICLE_v10011946mg [Citrus clementina] Length = 386 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 200 ASNIVVEAVDNSEKFTTNWQFGLFELHNSHYAAVCMETGDSIGG 69 AS IVVE+ D+ E T+NWQF L +L SHYAA+CME +S GG Sbjct: 281 ASEIVVESSDDPENLTSNWQFALLDLAGSHYAAICMEKENSAGG 324 >ref|XP_006430169.1| hypothetical protein CICLE_v10011946mg [Citrus clementina] gi|557532226|gb|ESR43409.1| hypothetical protein CICLE_v10011946mg [Citrus clementina] Length = 353 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 200 ASNIVVEAVDNSEKFTTNWQFGLFELHNSHYAAVCMETGDSIGG 69 AS IVVE+ D+ E T+NWQF L +L SHYAA+CME +S GG Sbjct: 248 ASEIVVESSDDPENLTSNWQFALLDLAGSHYAAICMEKENSAGG 291 >ref|XP_002322823.2| hypothetical protein POPTR_0016s07920g [Populus trichocarpa] gi|550321077|gb|EEF04584.2| hypothetical protein POPTR_0016s07920g [Populus trichocarpa] Length = 308 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 197 SNIVVEAVDNSEKFTTNWQFGLFELHNSHYAAVCME 90 S+IVVE+ D+ T NWQFGLFEL +SHYAAVCME Sbjct: 228 SSIVVESSDHPVSLTNNWQFGLFELASSHYAAVCME 263