BLASTX nr result
ID: Stemona21_contig00022810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00022810 (343 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003564552.1| PREDICTED: uncharacterized protein LOC100831... 76 4e-12 ref|XP_003564551.1| PREDICTED: uncharacterized protein LOC100831... 76 4e-12 ref|XP_004970488.1| PREDICTED: TBC1 domain family member 8B-like... 75 9e-12 tpg|DAA56959.1| TPA: hypothetical protein ZEAMMB73_114022 [Zea m... 75 9e-12 tpg|DAA56958.1| TPA: hypothetical protein ZEAMMB73_114022 [Zea m... 75 9e-12 tpg|DAA56957.1| TPA: hypothetical protein ZEAMMB73_114022 [Zea m... 75 9e-12 ref|XP_002458723.1| hypothetical protein SORBIDRAFT_03g039030 [S... 75 9e-12 ref|XP_006828267.1| hypothetical protein AMTR_s00023p00210990 [A... 74 3e-11 ref|XP_006644969.1| PREDICTED: TBC1 domain family member 8B-like... 73 3e-11 dbj|BAD73388.1| RabGAP/TBC domain-containing protein-like [Oryza... 73 3e-11 gb|EEE55636.1| hypothetical protein OsJ_03987 [Oryza sativa Japo... 73 3e-11 gb|EAY76404.1| hypothetical protein OsI_04332 [Oryza sativa Indi... 73 3e-11 ref|XP_006655389.1| PREDICTED: TBC1 domain family member 14-like... 72 6e-11 ref|XP_004961800.1| PREDICTED: TBC1 domain family member 10B-lik... 72 8e-11 gb|EMT17634.1| TBC1 domain family member 8B [Aegilops tauschii] 72 8e-11 gb|EMS65265.1| TBC1 domain family member 8B [Triticum urartu] 72 8e-11 gb|AFW82260.1| hypothetical protein ZEAMMB73_146044 [Zea mays] 72 8e-11 gb|AFW78305.1| hypothetical protein ZEAMMB73_281754 [Zea mays] 72 8e-11 ref|XP_003568275.1| PREDICTED: uncharacterized protein LOC100832... 72 8e-11 dbj|BAJ96047.1| predicted protein [Hordeum vulgare subsp. vulgare] 72 8e-11 >ref|XP_003564552.1| PREDICTED: uncharacterized protein LOC100831523 isoform 2 [Brachypodium distachyon] Length = 833 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKSLPFIAFEHKRDAYGFAVRPQHLQRYREYANIYK 38 >ref|XP_003564551.1| PREDICTED: uncharacterized protein LOC100831523 isoform 1 [Brachypodium distachyon] Length = 841 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKSLPFIAFEHKRDAYGFAVRPQHLQRYREYANIYK 38 >ref|XP_004970488.1| PREDICTED: TBC1 domain family member 8B-like [Setaria italica] Length = 843 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK K+LP + FEHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKALPFIAFEHKRDAYGFAVRPQHLQRYREYANIYK 38 >tpg|DAA56959.1| TPA: hypothetical protein ZEAMMB73_114022 [Zea mays] Length = 218 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK K+LP + FEHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKALPFIAFEHKRDAYGFAVRPQHLQRYREYANIYK 38 >tpg|DAA56958.1| TPA: hypothetical protein ZEAMMB73_114022 [Zea mays] Length = 831 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK K+LP + FEHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKALPFIAFEHKRDAYGFAVRPQHLQRYREYANIYK 38 >tpg|DAA56957.1| TPA: hypothetical protein ZEAMMB73_114022 [Zea mays] Length = 834 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK K+LP + FEHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKALPFIAFEHKRDAYGFAVRPQHLQRYREYANIYK 38 >ref|XP_002458723.1| hypothetical protein SORBIDRAFT_03g039030 [Sorghum bicolor] gi|241930698|gb|EES03843.1| hypothetical protein SORBIDRAFT_03g039030 [Sorghum bicolor] Length = 839 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK K+LP + FEHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKALPFIAFEHKRDAYGFAVRPQHLQRYREYANIYK 38 >ref|XP_006828267.1| hypothetical protein AMTR_s00023p00210990 [Amborella trichopoda] gi|548832914|gb|ERM95683.1| hypothetical protein AMTR_s00023p00210990 [Amborella trichopoda] Length = 822 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK K LPL+T EHKRDAYGF VRPQHLQRYREYANIYK Sbjct: 1 MKTKGLPLVTLEHKRDAYGFTVRPQHLQRYREYANIYK 38 >ref|XP_006644969.1| PREDICTED: TBC1 domain family member 8B-like [Oryza brachyantha] Length = 826 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + EHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKSLPFIAAEHKRDAYGFAVRPQHLQRYREYANIYK 38 >dbj|BAD73388.1| RabGAP/TBC domain-containing protein-like [Oryza sativa Japonica Group] Length = 843 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + EHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKSLPFIASEHKRDAYGFAVRPQHLQRYREYANIYK 38 >gb|EEE55636.1| hypothetical protein OsJ_03987 [Oryza sativa Japonica Group] Length = 854 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + EHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKSLPFIASEHKRDAYGFAVRPQHLQRYREYANIYK 38 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 262 EHKRDAYGFAVRPQHLQRYREYANIYK 342 E RDAYGFAVRPQHLQRYREYANIYK Sbjct: 84 EDGRDAYGFAVRPQHLQRYREYANIYK 110 >gb|EAY76404.1| hypothetical protein OsI_04332 [Oryza sativa Indica Group] Length = 824 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + EHKRDAYGFAVRPQHLQRYREYANIYK Sbjct: 1 MKAKSLPFIASEHKRDAYGFAVRPQHLQRYREYANIYK 38 >ref|XP_006655389.1| PREDICTED: TBC1 domain family member 14-like [Oryza brachyantha] Length = 825 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRY+EYA+IYK Sbjct: 1 MKPKSLPFIAFEHKRDAYGFAVRPQHLQRYKEYASIYK 38 >ref|XP_004961800.1| PREDICTED: TBC1 domain family member 10B-like [Setaria italica] Length = 818 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRY+EYA IYK Sbjct: 1 MKPKSLPFIAFEHKRDAYGFAVRPQHLQRYKEYAGIYK 38 >gb|EMT17634.1| TBC1 domain family member 8B [Aegilops tauschii] Length = 883 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRY+EYA IYK Sbjct: 1 MKPKSLPFIAFEHKRDAYGFAVRPQHLQRYKEYAGIYK 38 >gb|EMS65265.1| TBC1 domain family member 8B [Triticum urartu] Length = 834 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRY+EYA IYK Sbjct: 1 MKPKSLPFIAFEHKRDAYGFAVRPQHLQRYKEYAGIYK 38 >gb|AFW82260.1| hypothetical protein ZEAMMB73_146044 [Zea mays] Length = 813 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRY+EYA IYK Sbjct: 1 MKPKSLPFIAFEHKRDAYGFAVRPQHLQRYKEYAGIYK 38 >gb|AFW78305.1| hypothetical protein ZEAMMB73_281754 [Zea mays] Length = 806 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRY+EYA IYK Sbjct: 1 MKPKSLPFIAFEHKRDAYGFAVRPQHLQRYKEYAGIYK 38 >ref|XP_003568275.1| PREDICTED: uncharacterized protein LOC100832139 [Brachypodium distachyon] Length = 827 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRY+EYA IYK Sbjct: 1 MKPKSLPFIAFEHKRDAYGFAVRPQHLQRYKEYAGIYK 38 >dbj|BAJ96047.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 827 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 229 MKGKSLPLMTFEHKRDAYGFAVRPQHLQRYREYANIYK 342 MK KSLP + FEHKRDAYGFAVRPQHLQRY+EYA IYK Sbjct: 1 MKPKSLPFIAFEHKRDAYGFAVRPQHLQRYKEYAGIYK 38