BLASTX nr result
ID: Stemona21_contig00022668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00022668 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497263.1| PREDICTED: G patch domain-containing protein... 59 7e-07 ref|XP_004497262.1| PREDICTED: G patch domain-containing protein... 59 7e-07 >ref|XP_004497263.1| PREDICTED: G patch domain-containing protein 11-like isoform X2 [Cicer arietinum] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +3 Query: 168 QGRLEPLQTHVKKNKRGLGAENTKQKPVLPE-GPSSTEQNKHDHSYSKK 311 QGRLEP++THVK NKRGLGA+ K+K V P+ G SS NK +H KK Sbjct: 44 QGRLEPVETHVKNNKRGLGADKVKKKAVKPDHGDSSKGDNKQEHLSQKK 92 >ref|XP_004497262.1| PREDICTED: G patch domain-containing protein 11-like isoform X1 [Cicer arietinum] Length = 137 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +3 Query: 168 QGRLEPLQTHVKKNKRGLGAENTKQKPVLPE-GPSSTEQNKHDHSYSKK 311 QGRLEP++THVK NKRGLGA+ K+K V P+ G SS NK +H KK Sbjct: 53 QGRLEPVETHVKNNKRGLGADKVKKKAVKPDHGDSSKGDNKQEHLSQKK 101