BLASTX nr result
ID: Stemona21_contig00022504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00022504 (436 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008854435.1| photosystem I subunit VIII [Musa textilis] g... 67 2e-09 ref|YP_003587677.1| photosystem I subunit VIII [Anomochloa maran... 67 3e-09 ref|YP_001531292.1| psaI gene product (chloroplast) [Lolium pere... 67 3e-09 gb|AFA27264.1| photosystem I subunit VIII, partial [Georgeantha ... 66 4e-09 ref|YP_003029749.1| Psal [Bambusa oldhamii] gi|255961392|ref|YP_... 66 4e-09 gb|AFA27286.1| photosystem I subunit VIII [Syngonanthus chrysant... 65 7e-09 ref|NP_114268.1| photosystem I subunit VIII [Triticum aestivum] ... 65 9e-09 gb|AFA27288.1| photosystem I subunit VIII, partial [Tradescantia... 65 9e-09 ref|YP_319774.1| PSI reaction centre subunit VIII [Acorus calamu... 65 1e-08 ref|NP_043034.1| photosystem I subunit VIII [Zea mays] gi|400872... 65 1e-08 gb|AFA27253.1| photosystem I subunit VIII, partial [Belosynapsis... 65 1e-08 gb|AEX95892.1| photosystem I subunit VIII (chloroplast) [Drimia ... 65 1e-08 ref|YP_001595518.1| PSI reaction center subunit VIII [Lemna mino... 65 1e-08 ref|YP_005352717.1| psaI gene product (chloroplast) [Ginkgo bilo... 64 2e-08 ref|YP_053165.1| PSI reaction centre subunit VIII [Nymphaea alba... 64 2e-08 gb|AFA27248.1| photosystem I subunit VIII [Abolboda macrostachya] 64 2e-08 gb|AEX95890.1| photosystem I subunit VIII (chloroplast) [Phormiu... 64 2e-08 ref|XP_003573958.1| PREDICTED: photosystem I reaction center sub... 64 2e-08 ref|NP_039395.1| photosystem I subunit VIII [Oryza sativa Japoni... 64 2e-08 gb|AEX95885.1| photosystem I subunit VIII (chloroplast) [Aloe ve... 64 3e-08 >ref|YP_008854435.1| photosystem I subunit VIII [Musa textilis] gi|156598370|gb|ABU85445.1| photosystem I subunit VIII [Musa acuminata] gi|525312467|emb|CCW72385.1| psaI (chloroplast) [Musa acuminata subsp. malaccensis] gi|557636922|gb|AHA12524.1| photosystem I subunit VIII [Musa textilis] Length = 36 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTDPNLPSIFVPLVGLVFPAIAM SLF +VQKNKI Sbjct: 1 MTDPNLPSIFVPLVGLVFPAIAMVSLFLHVQKNKI 35 >ref|YP_003587677.1| photosystem I subunit VIII [Anomochloa marantoidea] gi|251765261|gb|ACT15415.1| photosystem I subunit VIII [Anomochloa marantoidea] Length = 36 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIAMASLF YVQKNKI Sbjct: 1 MTDLNLPSIFVPLVGLVFPAIAMASLFLYVQKNKI 35 >ref|YP_001531292.1| psaI gene product (chloroplast) [Lolium perenne] gi|194033158|ref|YP_002000496.1| PSI small peptide [Brachypodium distachyon] gi|218176253|ref|YP_002364510.1| photosystem I subunit VIII [Festuca arundinacea] gi|426406648|ref|YP_007026562.1| photosystem I subunit VIII [Festuca ovina] gi|427436984|ref|YP_007026476.1| photosystem I subunit VIII [Festuca altissima] gi|427437081|ref|YP_007026648.1| photosystem I subunit VIII [Festuca pratensis] gi|427437227|ref|YP_007026734.1| photosystem I subunit VIII [Lolium multiflorum] gi|357124550|ref|XP_003563962.1| PREDICTED: photosystem I reaction center subunit VIII-like [Brachypodium distachyon] gi|357132154|ref|XP_003567697.1| PREDICTED: photosystem I reaction center subunit VIII-like [Brachypodium distachyon] gi|357133131|ref|XP_003568181.1| PREDICTED: photosystem I reaction center subunit VIII-like [Brachypodium distachyon] gi|158934407|emb|CAO85985.1| photosystem I subunit VIII (chloroplast) [Lolium perenne] gi|193075566|gb|ACF08649.1| PSI small peptide (chloroplast) [Brachypodium distachyon] gi|215882337|gb|ACJ70767.1| photosystem I subunit VIII [Festuca arundinacea] gi|374974331|gb|AFA27261.1| photosystem I subunit VIII, partial [Eleusine coracana] gi|374974333|gb|AFA27262.1| photosystem I subunit VIII, partial [Flagellaria indica] gi|374974345|gb|AFA27268.1| photosystem I subunit VIII [Joinvillea ascendens] gi|374974379|gb|AFA27285.1| photosystem I subunit VIII, partial [Streptochaeta angustifolia] gi|410177775|gb|AFV62656.1| photosystem I subunit VIII [Festuca altissima] gi|410177862|gb|AFV62742.1| photosystem I subunit VIII [Festuca ovina] gi|410177949|gb|AFV62828.1| photosystem I subunit VIII [Festuca pratensis] gi|410178036|gb|AFV62914.1| photosystem I subunit VIII [Lolium multiflorum] gi|582041343|gb|AHI43053.1| photosystem I subunit VIII [Deschampsia antarctica] Length = 36 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIAMASLF YVQKNKI Sbjct: 1 MTDLNLPSIFVPLVGLVFPAIAMASLFLYVQKNKI 35 >gb|AFA27264.1| photosystem I subunit VIII, partial [Georgeantha hexandra] Length = 36 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGL+FPAIAMASLF YVQKNKI Sbjct: 1 MTDLNLPSIFVPLVGLIFPAIAMASLFLYVQKNKI 35 >ref|YP_003029749.1| Psal [Bambusa oldhamii] gi|255961392|ref|YP_003097585.1| photosystem I reaction center subunit VIII [Dendrocalamus latiflorus] gi|339906461|ref|YP_004733254.1| photosystem I subunit VIII [Indocalamus longiauritus] gi|340034036|ref|YP_004733588.1| photosystem I subunit VIII [Phyllostachys edulis] gi|340034207|ref|YP_004733770.1| photosystem I subunit VIII [Acidosasa purpurea] gi|340034375|ref|YP_004733988.1| photosystem I subunit VIII [Phyllostachys nigra var. henonis] gi|340034460|ref|YP_004734111.1| photosystem I subunit VIII [Bambusa emeiensis] gi|340034546|ref|YP_004734195.1| photosystem I subunit VIII [Ferrocalamus rimosivaginus] gi|345895226|ref|YP_004841958.1| photosystem I subunit VIII [Panicum virgatum] gi|374249360|ref|YP_005088542.1| psaI gene product (chloroplast) [Phyllostachys propinqua] gi|374249629|ref|YP_005089156.1| psaI gene product [Rhynchoryza subulata] gi|377819388|ref|YP_005097884.1| PSI reaction center subunit VIII (chloroplast) [Colocasia esculenta] gi|452849492|ref|YP_007475149.1| photosystem I subunit VIII (chloroplast) [Arundinaria gigantea] gi|511347591|ref|YP_008080513.1| photosystem I protein I (chloroplast) [Pharus latifolius] gi|558603680|ref|YP_008815760.1| photosystem I subunit VIII [Setaria italica] gi|563354789|ref|YP_008855100.1| photosystem I subunit VIII (chloroplast) [Phragmites australis] gi|570700324|ref|YP_008993984.1| photosystem I subunit VIII (chloroplast) [Pharus lappulaceus] gi|586929241|ref|YP_009002002.1| photosystem I subunit VIII (chloroplast) [Puelia olyriformis] gi|514825323|ref|XP_004987316.1| PREDICTED: photosystem I reaction center subunit VIII-like [Setaria italica] gi|514825353|ref|XP_004987330.1| PREDICTED: photosystem I reaction center subunit VIII-like [Setaria italica] gi|246367076|gb|ACS94687.1| Psal [Bambusa oldhamii] gi|255040269|gb|ACT99929.1| photosystem I reaction center subunit VIII [Dendrocalamus latiflorus] gi|307133896|gb|ADN32901.1| photosystem I subunit VIII [Phyllostachys nigra var. henonis] gi|309321627|gb|ADO65152.1| photosystem I subunit VIII [Acidosasa purpurea] gi|309321711|gb|ADO65235.1| photosystem I subunit VIII [Ferrocalamus rimosivaginus] gi|309321794|gb|ADO65317.1| photosystem I subunit VIII [Indocalamus longiauritus] gi|309321878|gb|ADO65400.1| photosystem I subunit VIII [Phyllostachys edulis] gi|309321963|gb|ADO65484.1| photosystem I subunit VIII [Bambusa emeiensis] gi|319412328|gb|ADV41864.1| photosystem I subunit VIII (chloroplast) [Panicum virgatum] gi|319412415|gb|ADV41950.1| photosystem I subunit VIII (chloroplast) [Panicum virgatum] gi|336280812|gb|AEI29100.1| photosystem I protein I (chloroplast) [Pharus latifolius] gi|340536649|gb|AEK48416.1| PSI reaction center subunit VIII (chloroplast) [Colocasia esculenta] gi|340536736|gb|AEK48502.1| PSI reaction center subunit VIII (chloroplast) [Colocasia esculenta] gi|346228397|gb|AEO21270.1| photosystem I subunit VIII (chloroplast) [Phyllostachys propinqua] gi|346228481|gb|AEO21353.1| photosystem I subunit VIII [Rhynchoryza subulata] gi|441480260|gb|AGC38172.1| photosystem I subunit VIII (chloroplast) [Arundinaria gigantea] gi|449020268|gb|AGE65765.1| photosystem I subunit VIII (chloroplast) [Pharus lappulaceus] gi|469474012|gb|AGH33782.1| photosystem I subunit VIII (chloroplast) [Puelia olyriformis] gi|555298052|gb|AGZ13154.1| photosystem I subunit VIII [Setaria italica] gi|558614299|gb|AHA82309.1| photosystem I subunit VIII (chloroplast) [Phragmites australis] Length = 36 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIAMASLF YVQKNKI Sbjct: 1 MTDFNLPSIFVPLVGLVFPAIAMASLFLYVQKNKI 35 >gb|AFA27286.1| photosystem I subunit VIII [Syngonanthus chrysanthus] Length = 36 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGL+FPAIAMASLF YVQKNKI Sbjct: 1 MTDLNLPSIFVPLVGLLFPAIAMASLFLYVQKNKI 35 >ref|NP_114268.1| photosystem I subunit VIII [Triticum aestivum] gi|48478780|ref|YP_024388.1| photosystem I subunit VIII [Saccharum hybrid cultivar SP-80-3280] gi|50812537|ref|YP_054640.1| photosystem I subunit VIII [Saccharum hybrid cultivar NCo 310] gi|118430312|ref|YP_874746.1| photosystem I subunit VIII [Agrostis stolonifera] gi|118614502|ref|YP_899417.1| photosystem I subunit VIII [Sorghum bicolor] gi|260677428|ref|YP_003208196.1| photosystem I subunit VIII [Coix lacryma-jobi] gi|525778514|ref|YP_008239102.1| photosystem I subunit VIII (chloroplast) [Triticum monococcum] gi|525782225|ref|YP_008239181.1| photosystem I subunit VIII (chloroplast) [Secale cereale] gi|533310114|ref|YP_008474309.1| photosystem I subunit VIII (chloroplast) [Aegilops tauschii] gi|533310210|ref|YP_008474400.1| photosystem I subunit VIII (chloroplast) [Aegilops speltoides] gi|568245005|ref|YP_008963913.1| photosystem I subunit VIII (chloroplast) [Aegilops geniculata] gi|568247003|ref|YP_008963836.1| photosystem I subunit VIII (chloroplast) [Aegilops cylindrica] gi|60390396|sp|Q6ENV4.1|PSAI_SACOF RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|60390452|sp|Q6L603.1|PSAI_AEGSP RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|60392943|sp|P69396.1|PSAI_AEGCR RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|60392944|sp|P69397.1|PSAI_AEGTA RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|60392945|sp|P69398.1|PSAI_WHEAT RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|75261493|sp|Q6L390.1|PSAI_SACHY RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|125964534|sp|A1EA18.1|PSAI_AGRST RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|125964640|sp|A1E9T4.1|PSAI_SORBI RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|11310|emb|CAA44035.1| psaI [Aegilops crassa] gi|11326|emb|CAA44039.1| psa I [Aegilops tauschii] gi|12345|emb|CAA44029.1| psaI [Triticum aestivum] gi|13928214|dbj|BAB47043.1| PSI small peptide [Triticum aestivum] gi|48147239|dbj|BAD22547.1| PSI small peptid [Aegilops markgrafii] gi|48147243|dbj|BAD22550.1| PSI small peptid [Aegilops speltoides] gi|48147247|dbj|BAD22553.1| PSI small peptid [Amblyopyrum muticum] gi|48147251|dbj|BAD22556.1| PSI small peptid [Aegilops geniculata] gi|48478682|gb|AAT44702.1| photosystem I subunit VIII [Saccharum hybrid cultivar SP80-3280] gi|49659521|dbj|BAD27302.1| PSI I-protein [Saccharum hybrid cultivar NCo 310] gi|118201136|gb|ABK79506.1| photosystem I subunit VIII [Sorghum bicolor] gi|118201221|gb|ABK79590.1| photosystem I subunit VIII [Agrostis stolonifera] gi|209361366|gb|ACI43281.1| photosystem I subunit VIII [Coix lacryma-jobi] gi|384406861|gb|AFH89518.1| photosystem I subunit VIII (chloroplast) [Aegilops tauschii] gi|394986501|gb|AFN42382.1| photosystem I subunit VIII (chloroplast) [Aegilops speltoides] gi|521301199|gb|AGP50999.1| photosystem I subunit VIII (chloroplast) [Triticum monococcum] gi|521301279|gb|AGP51078.1| photosystem I subunit VIII (chloroplast) [Secale cereale] gi|521301356|gb|AGP51154.1| photosystem I subunit VIII (chloroplast) [Triticum monococcum subsp. aegilopoides] gi|521301496|gb|AGP51292.1| photosystem I subunit VIII (chloroplast) [Triticum aestivum] gi|554515563|gb|AGY92866.1| photosystem I subunit VIII (chloroplast) [Aegilops cylindrica] gi|554515641|gb|AGY92943.1| photosystem I subunit VIII (chloroplast) [Aegilops geniculata] Length = 36 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIAM SLF YVQKNKI Sbjct: 1 MTDLNLPSIFVPLVGLVFPAIAMTSLFLYVQKNKI 35 >gb|AFA27288.1| photosystem I subunit VIII, partial [Tradescantia ohiensis] Length = 36 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPS FVPLVGLVFPAIAMASLF YVQKNKI Sbjct: 1 MTDLNLPSFFVPLVGLVFPAIAMASLFLYVQKNKI 35 >ref|YP_319774.1| PSI reaction centre subunit VIII [Acorus calamus] gi|161622319|ref|YP_001586191.1| photosystem I subunit VIII [Acorus americanus] gi|69217683|gb|AAZ04099.1| photosystem I subunit VIII [Acorus americanus] gi|69217693|gb|AAZ04104.1| photosystem I subunit VIII [Yucca schidigera] gi|74381718|emb|CAI53803.1| PSI reaction centre subunit VIII [Acorus calamus] gi|160369862|gb|ABX38753.1| photosystem I subunit VIII [Acorus americanus] gi|372484452|gb|AEX95867.1| photosystem I subunit VIII (chloroplast) [Agapanthus africanus] gi|372484454|gb|AEX95868.1| photosystem I subunit VIII (chloroplast) [Anemarrhena asphodeloides] gi|372484458|gb|AEX95870.1| photosystem I subunit VIII (chloroplast) [Echeandia sp. Steele 1101] gi|372484460|gb|AEX95871.1| photosystem I subunit VIII (chloroplast) [Hosta ventricosa] gi|372484462|gb|AEX95872.1| photosystem I subunit VIII (chloroplast) [Manfreda virginica] gi|372484464|gb|AEX95873.1| photosystem I subunit VIII (chloroplast) [Polianthes sp. Pires 2011-05] gi|372484473|gb|AEX95877.1| photosystem I subunit VIII (chloroplast) [Amaryllis belladonna] gi|372484475|gb|AEX95878.1| photosystem I subunit VIII (chloroplast) [Crinum asiaticum] gi|372484477|gb|AEX95879.1| photosystem I subunit VIII (chloroplast) [Eucharis x grandiflora] gi|372484479|gb|AEX95880.1| photosystem I subunit VIII (chloroplast) [Scadoxus cinnabarinus] gi|372484481|gb|AEX95881.1| photosystem I subunit VIII (chloroplast) [Aphyllanthes monspeliensis] gi|372484483|gb|AEX95882.1| photosystem I subunit VIII (chloroplast) [Asparagus officinalis] gi|372484485|gb|AEX95883.1| photosystem I subunit VIII (chloroplast) [Asparagus asparagoides] gi|372484487|gb|AEX95884.1| photosystem I subunit VIII (chloroplast) [Hemiphylacus alatostylus] gi|372484497|gb|AEX95889.1| photosystem I subunit VIII (chloroplast) [Doryanthes palmeri] gi|372484505|gb|AEX95893.1| photosystem I subunit VIII (chloroplast) [Ledebouria cordifolia] gi|372484509|gb|AEX95895.1| photosystem I subunit VIII (chloroplast) [Oziroe biflora] gi|372484511|gb|AEX95896.1| photosystem I subunit VIII (chloroplast) [Iris tenax] gi|372484513|gb|AEX95897.1| photosystem I subunit VIII (chloroplast) [Cordyline australis] gi|372484515|gb|AEX95898.1| photosystem I subunit VIII (chloroplast) [Trichopetalum plumosum] gi|372484517|gb|AEX95899.1| photosystem I subunit VIII (chloroplast) [Calibanus hookeri] gi|372484519|gb|AEX95900.1| photosystem I subunit VIII (chloroplast) [Dasylirion wheeleri] gi|372484521|gb|AEX95901.1| photosystem I subunit VIII (chloroplast) [Eriospermum cervicorne] gi|372484523|gb|AEX95902.1| photosystem I subunit VIII (chloroplast) [Liriope spicata] gi|372484525|gb|AEX95903.1| photosystem I subunit VIII (chloroplast) [Ophiopogon japonicus] gi|372484527|gb|AEX95904.1| photosystem I subunit VIII (chloroplast) [Ruscus aculeatus] gi|372484529|gb|AEX95905.1| photosystem I subunit VIII (chloroplast) [Sansevieria trifasciata] gi|372484531|gb|AEX95906.1| photosystem I subunit VIII (chloroplast) [Maianthemum stellatum] gi|372484543|gb|AEX95912.1| photosystem I subunit VIII (chloroplast) [Triteleia hyacinthina] gi|374974307|gb|AFA27249.1| photosystem I subunit VIII [Agapanthus praecox] gi|374974313|gb|AFA27252.1| photosystem I subunit VIII, partial [Asparagus officinalis] gi|374974323|gb|AFA27257.1| photosystem I subunit VIII, partial [Chlorophytum rhizopendulum] gi|374974325|gb|AFA27258.1| photosystem I subunit VIII [Molineria capitulata] gi|374974339|gb|AFA27265.1| photosystem I subunit VIII, partial [Hesperaloe parviflora] gi|374974341|gb|AFA27266.1| photosystem I subunit VIII, partial [Hosta ventricosa] gi|374974343|gb|AFA27267.1| photosystem I subunit VIII, partial [Iris virginica] gi|374974353|gb|AFA27272.1| photosystem I subunit VIII [Lomandra longifolia] gi|374974361|gb|AFA27276.1| photosystem I subunit VIII, partial [Nolina atopocarpa] Length = 36 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIAMASLF +VQKNKI Sbjct: 1 MTDLNLPSIFVPLVGLVFPAIAMASLFLHVQKNKI 35 >ref|NP_043034.1| photosystem I subunit VIII [Zea mays] gi|400872|sp|P30980.1|PSAI_MAIZE RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|12433|emb|CAA43491.1| photosystem I subunit [Zea mays] gi|902231|emb|CAA60295.1| psaI [Zea mays] gi|195610002|gb|ACG26831.1| hypothetical protein [Zea mays] gi|413918272|gb|AFW58204.1| photosystem I reaction center subunit VIII [Zea mays] gi|444322|prf||1906371A psaI gene Length = 36 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIAM SLF YVQKNKI Sbjct: 1 MTDFNLPSIFVPLVGLVFPAIAMTSLFLYVQKNKI 35 >gb|AFA27253.1| photosystem I subunit VIII, partial [Belosynapsis ciliata] Length = 36 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPS FVPLVGLVFPAIAMASLF YVQKNKI Sbjct: 1 MTDFNLPSFFVPLVGLVFPAIAMASLFLYVQKNKI 35 >gb|AEX95892.1| photosystem I subunit VIII (chloroplast) [Drimia altissima] gi|372484507|gb|AEX95894.1| photosystem I subunit VIII (chloroplast) [Ornithogalum tenuifolium] gi|374974309|gb|AFA27250.1| photosystem I subunit VIII [Albuca kirkii] Length = 36 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIA+ASLF YVQKNKI Sbjct: 1 MTDFNLPSIFVPLVGLVFPAIAIASLFLYVQKNKI 35 >ref|YP_001595518.1| PSI reaction center subunit VIII [Lemna minor] gi|342316131|ref|YP_004769640.1| photosystem I subunit VIII (chloroplast) [Spirodela polyrhiza] gi|342316300|ref|YP_004769822.1| photosystem I subunit VIII (chloroplast) [Wolffiella lingulata] gi|342316384|ref|YP_004769957.1| photosystem I subunit VIII (chloroplast) [Wolffia australiana] gi|88696780|gb|ABD48505.1| PSI reaction center subunit VIII [Lemna minor] gi|341834081|gb|AEK94352.1| photosystem I subunit VIII [Spirodela polyrhiza] gi|341834165|gb|AEK94435.1| photosystem I subunit VIII [Wolffiella lingulata] gi|341834249|gb|AEK94518.1| photosystem I subunit VIII [Wolffia australiana] Length = 36 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPA AMASLF YVQKNKI Sbjct: 1 MTDFNLPSIFVPLVGLVFPAFAMASLFLYVQKNKI 35 >ref|YP_005352717.1| psaI gene product (chloroplast) [Ginkgo biloba] gi|69217685|gb|AAZ04100.1| photosystem I subunit VIII [Ginkgo biloba] gi|372862348|gb|AEX98430.1| photosystem I subunit VIII (chloroplast) [Ginkgo biloba] gi|372862771|gb|AEX98848.1| photosystem I subunit VIII (chloroplast) [Ginkgo biloba] gi|372862940|gb|AEX99015.1| photosystem I subunit VIII (chloroplast) [Ginkgo biloba] gi|380356180|dbj|BAL72602.1| photosystem I subunit VIII (chloroplast) [Ginkgo biloba] Length = 36 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTDPNLPSIFVPL GL+FPAIAMA L+FYVQK KI Sbjct: 1 MTDPNLPSIFVPLAGLLFPAIAMAFLYFYVQKKKI 35 >ref|YP_053165.1| PSI reaction centre subunit VIII [Nymphaea alba] gi|60390401|sp|Q6EW69.1|PSAI_NYMAL RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|50250337|emb|CAF28603.1| PSI reaction centre subunit VIII [Nymphaea alba] Length = 36 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGL+FPAIAM SLFF+VQKNKI Sbjct: 1 MTDLNLPSIFVPLVGLLFPAIAMVSLFFHVQKNKI 35 >gb|AFA27248.1| photosystem I subunit VIII [Abolboda macrostachya] Length = 36 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIAMASLF YVQK KI Sbjct: 1 MTDLNLPSIFVPLVGLVFPAIAMASLFLYVQKKKI 35 >gb|AEX95890.1| photosystem I subunit VIII (chloroplast) [Phormium tenax] gi|372484535|gb|AEX95908.1| photosystem I subunit VIII (chloroplast) [Brodiaea californica] gi|372484537|gb|AEX95909.1| photosystem I subunit VIII (chloroplast) [Dichelostemma capitatum] gi|372484539|gb|AEX95910.1| photosystem I subunit VIII (chloroplast) [Dichelostemma congestum] gi|372484541|gb|AEX95911.1| photosystem I subunit VIII (chloroplast) [Dichelostemma ida-maia] gi|372484545|gb|AEX95913.1| photosystem I subunit VIII (chloroplast) [Xanthorrhoea preissii] gi|374974365|gb|AFA27278.1| photosystem I subunit VIII, partial [Phormium tenax] Length = 36 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIAMASLF +VQKNKI Sbjct: 1 MTDFNLPSIFVPLVGLVFPAIAMASLFLHVQKNKI 35 >ref|XP_003573958.1| PREDICTED: photosystem I reaction center subunit VIII-like [Brachypodium distachyon] Length = 36 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLP IFVPLVGLVFPAIAMASLF YVQKNKI Sbjct: 1 MTDLNLPLIFVPLVGLVFPAIAMASLFLYVQKNKI 35 >ref|NP_039395.1| photosystem I subunit VIII [Oryza sativa Japonica Group] gi|50233981|ref|YP_052759.1| photosystem I subunit VIII [Oryza nivara] gi|374249276|ref|YP_005088019.1| psaI gene product [Leersia tisserantii] gi|378758424|ref|YP_005296428.1| psaI gene product (chloroplast) [Oryza meridionalis] gi|386799180|ref|YP_006280769.1| psaI gene product (chloroplast) [Oryza rufipogon] gi|556927096|ref|YP_008757450.1| photosystem I subunit VIII (chloroplast) [Oryza rufipogon] gi|131205|sp|P12186.1|PSAI_ORYSJ RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|60390391|sp|Q6ENG4.1|PSAI_ORYNI RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|148880113|sp|P0C372.1|PSAI_ORYSI RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|148952837|sp|P0C371.1|PSAI_ORYSA RecName: Full=Photosystem I reaction center subunit VIII; Short=PSI-I gi|11996|emb|CAA33957.1| unnamed protein product [Oryza sativa Japonica Group] gi|49615005|dbj|BAD26788.1| photosystem I subunit VIII [Oryza nivara] gi|50725466|dbj|BAD32937.1| photosystem I subunit VIII psaI _ chloroplast [Oryza sativa Japonica Group] gi|50725592|dbj|BAD33060.1| photosystem I subunit VIII psaI _ chloroplast [Oryza sativa Japonica Group] gi|56784298|dbj|BAD81980.1| Chloroplast photosystem I subunit VIII [Oryza sativa Japonica Group] gi|261883638|gb|ACY05518.1| photosystem I subunit VIII [Oryza sativa Indica Group] gi|336326848|gb|AEI53026.1| photosystem I subunit VIII (chloroplast) [Oryza meridionalis] gi|336326924|gb|AEI53101.1| photosystem I subunit VIII (chloroplast) [Oryza rufipogon] gi|336327002|gb|AEI53178.1| photosystem I subunit VIII (chloroplast) [Oryza rufipogon] gi|346228313|gb|AEO21187.1| photosystem I subunit VIII [Leersia tisserantii] gi|353685063|gb|AER12828.1| photosystem I subunit VIII (chloroplast) [Oryza sativa Indica Group] gi|353685151|gb|AER12915.1| photosystem I subunit VIII (chloroplast) [Oryza sativa Indica Group] gi|441480344|gb|AGC38255.1| photosystem I subunit VIII (chloroplast) [Cryptochloa strictiflora] gi|552954488|gb|AGY48956.1| photosystem I subunit VIII (chloroplast) [Oryza rufipogon] gi|555945998|gb|AGZ19224.1| photosystem I subunit VIII (chloroplast) [Oryza rufipogon] gi|226617|prf||1603356AP photosystem I small peptide Length = 36 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 M D NLPSIFVPLVGLVFPAIAMASLF YVQKNKI Sbjct: 1 MMDFNLPSIFVPLVGLVFPAIAMASLFLYVQKNKI 35 >gb|AEX95885.1| photosystem I subunit VIII (chloroplast) [Aloe vera] gi|372484493|gb|AEX95887.1| photosystem I subunit VIII (chloroplast) [Haworthia cymbiformis] Length = 36 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 123 MTDPNLPSIFVPLVGLVFPAIAMASLFFYVQKNKI 19 MTD NLPSIFVPLVGLVFPAIAM+SLF +VQKNKI Sbjct: 1 MTDLNLPSIFVPLVGLVFPAIAMSSLFLHVQKNKI 35