BLASTX nr result
ID: Stemona21_contig00022365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00022365 (303 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002468460.1| hypothetical protein SORBIDRAFT_01g046290 [S... 56 4e-06 >ref|XP_002468460.1| hypothetical protein SORBIDRAFT_01g046290 [Sorghum bicolor] gi|241922314|gb|EER95458.1| hypothetical protein SORBIDRAFT_01g046290 [Sorghum bicolor] Length = 529 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 2 SAVWRALRTVELSKAKGNNPWADEISELPVHVPKM 106 SAVW+ALRTV+ + + NNPWADEI +LPVHVPK+ Sbjct: 477 SAVWKALRTVDDAARETNNPWADEIDDLPVHVPKV 511