BLASTX nr result
ID: Stemona21_contig00022002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00022002 (2016 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492967.1| PREDICTED: uncharacterized protein LOC102613... 64 5e-13 >ref|XP_006492967.1| PREDICTED: uncharacterized protein LOC102613431 [Citrus sinensis] Length = 142 Score = 63.9 bits (154), Expect(2) = 5e-13 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -2 Query: 1637 GPDCYKVWVNEIVVQGAPLFRPTQEFFTIDDAKGSTIAWPCKYITY 1500 GPD YKVWV+E+ L RPTQEFF + DAKGSTIAWP K + + Sbjct: 76 GPDYYKVWVDEVNKPSLSLVRPTQEFFNLGDAKGSTIAWPIKNLKF 121 Score = 39.3 bits (90), Expect(2) = 5e-13 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = -1 Query: 1776 STGIPSTQNIENSYCELLSWLRTRQVIARGQIASQDPQA 1660 ST IP+T C+LL+WL T +V+A+G IA+ +P+A Sbjct: 31 STAIPNTPT-NGDICKLLNWLGTGEVVAKGMIAATNPEA 68