BLASTX nr result
ID: Stemona21_contig00020146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00020146 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006391848.1| hypothetical protein EUTSA_v10023246mg [Eutr... 56 4e-06 >ref|XP_006391848.1| hypothetical protein EUTSA_v10023246mg [Eutrema salsugineum] gi|557088354|gb|ESQ29134.1| hypothetical protein EUTSA_v10023246mg [Eutrema salsugineum] Length = 919 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/53 (52%), Positives = 34/53 (64%), Gaps = 4/53 (7%) Frame = +2 Query: 2 INIQNCPKLKKLPLRSQSAP----GIKIIKATKDWFDALEWEDESIKSRLQNL 148 I++ NCP LKKLPL SQS P G+ I WFD LEWEDE+ K+R +L Sbjct: 855 ISVYNCPSLKKLPLNSQSGPHGEYGLIIEYIEFKWFDGLEWEDEATKTRFVHL 907