BLASTX nr result
ID: Stemona21_contig00018655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00018655 (436 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844391.1| hypothetical protein AMTR_s00142p00088550 [A... 62 8e-08 ref|XP_006450572.1| hypothetical protein CICLE_v10009098mg [Citr... 60 4e-07 ref|XP_006450571.1| hypothetical protein CICLE_v10009098mg [Citr... 60 4e-07 ref|XP_006356618.1| PREDICTED: psbP domain-containing protein 5,... 59 7e-07 ref|XP_004245232.1| PREDICTED: psbP domain-containing protein 5,... 59 7e-07 gb|EXC20796.1| PsbP domain-containing protein 5 [Morus notabilis] 58 1e-06 ref|XP_006399651.1| hypothetical protein EUTSA_v10014231mg [Eutr... 58 1e-06 ref|XP_006399650.1| hypothetical protein EUTSA_v10014231mg [Eutr... 58 1e-06 ref|XP_002284586.1| PREDICTED: psbP domain-containing protein 5,... 57 3e-06 emb|CAN63319.1| hypothetical protein VITISV_026424 [Vitis vinifera] 57 3e-06 ref|XP_002309586.2| hypothetical protein POPTR_0006s26270g [Popu... 57 3e-06 gb|EOY31356.1| Mog1/PsbP/DUF1795-like photosystem II reaction ce... 57 3e-06 ref|XP_004160856.1| PREDICTED: psbP domain-containing protein 5,... 57 3e-06 ref|XP_004138754.1| PREDICTED: psbP domain-containing protein 5,... 57 3e-06 ref|XP_002516607.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 gb|EMJ24521.1| hypothetical protein PRUPE_ppa009525mg [Prunus pe... 55 1e-05 gb|ABK26604.1| unknown [Picea sitchensis] 55 1e-05 >ref|XP_006844391.1| hypothetical protein AMTR_s00142p00088550 [Amborella trichopoda] gi|548846837|gb|ERN06066.1| hypothetical protein AMTR_s00142p00088550 [Amborella trichopoda] Length = 250 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 328 VQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 V IGPPNSRFLKS DKN WNAKDV D++LSDKS+L Sbjct: 81 VSIGPPNSRFLKSKDKNTWNAKDVADALLSDKSSL 115 >ref|XP_006450572.1| hypothetical protein CICLE_v10009098mg [Citrus clementina] gi|568844626|ref|XP_006476185.1| PREDICTED: psbP domain-containing protein 5, chloroplastic-like isoform X2 [Citrus sinensis] gi|557553798|gb|ESR63812.1| hypothetical protein CICLE_v10009098mg [Citrus clementina] Length = 258 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPN +FLKS DK+ WNAKDV DSVLSDKSAL Sbjct: 144 LIISVTIGPPNVQFLKSKDKSTWNAKDVADSVLSDKSAL 182 >ref|XP_006450571.1| hypothetical protein CICLE_v10009098mg [Citrus clementina] gi|568844624|ref|XP_006476184.1| PREDICTED: psbP domain-containing protein 5, chloroplastic-like isoform X1 [Citrus sinensis] gi|557553797|gb|ESR63811.1| hypothetical protein CICLE_v10009098mg [Citrus clementina] Length = 289 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPN +FLKS DK+ WNAKDV DSVLSDKSAL Sbjct: 144 LIISVTIGPPNVQFLKSKDKSTWNAKDVADSVLSDKSAL 182 >ref|XP_006356618.1| PREDICTED: psbP domain-containing protein 5, chloroplastic-like [Solanum tuberosum] Length = 295 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPNS+FLKS +K+ W+AKDV DSVLSDKSAL Sbjct: 149 LIISVSIGPPNSQFLKSKEKSTWSAKDVADSVLSDKSAL 187 >ref|XP_004245232.1| PREDICTED: psbP domain-containing protein 5, chloroplastic-like [Solanum lycopersicum] Length = 295 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPNS+FLKS +K+ W+AKDV DSVLSDKSAL Sbjct: 149 LIISVSIGPPNSQFLKSKEKSTWSAKDVADSVLSDKSAL 187 >gb|EXC20796.1| PsbP domain-containing protein 5 [Morus notabilis] Length = 268 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPNSRF+KS DK+ W KDV DSVLSDK+AL Sbjct: 123 LIISVTIGPPNSRFIKSKDKSTWTTKDVADSVLSDKAAL 161 >ref|XP_006399651.1| hypothetical protein EUTSA_v10014231mg [Eutrema salsugineum] gi|557100741|gb|ESQ41104.1| hypothetical protein EUTSA_v10014231mg [Eutrema salsugineum] Length = 298 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPNSRFL S +K W AKDV DSVLSDKSAL Sbjct: 153 LVISVSIGPPNSRFLTSKEKKTWTAKDVADSVLSDKSAL 191 >ref|XP_006399650.1| hypothetical protein EUTSA_v10014231mg [Eutrema salsugineum] gi|557100740|gb|ESQ41103.1| hypothetical protein EUTSA_v10014231mg [Eutrema salsugineum] Length = 296 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPNSRFL S +K W AKDV DSVLSDKSAL Sbjct: 151 LVISVSIGPPNSRFLTSKEKKTWTAKDVADSVLSDKSAL 189 >ref|XP_002284586.1| PREDICTED: psbP domain-containing protein 5, chloroplastic [Vitis vinifera] gi|296081930|emb|CBI20935.3| unnamed protein product [Vitis vinifera] Length = 284 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPNS+FLKS DK W AKDV DSVL+DK+AL Sbjct: 139 LIISVTIGPPNSQFLKSKDKGTWTAKDVADSVLADKAAL 177 >emb|CAN63319.1| hypothetical protein VITISV_026424 [Vitis vinifera] Length = 268 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPNS+FLKS DK W AKDV DSVL+DK+AL Sbjct: 123 LIISVTIGPPNSQFLKSKDKGTWTAKDVADSVLADKAAL 161 >ref|XP_002309586.2| hypothetical protein POPTR_0006s26270g [Populus trichocarpa] gi|550337123|gb|EEE93109.2| hypothetical protein POPTR_0006s26270g [Populus trichocarpa] Length = 295 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPN +F+KS DKN W AKDV DSVLSDKS+L Sbjct: 150 LILSVSIGPPNLQFVKSKDKNTWAAKDVADSVLSDKSSL 188 >gb|EOY31356.1| Mog1/PsbP/DUF1795-like photosystem II reaction center PsbP family protein [Theobroma cacao] Length = 294 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPN +FLKS DK W AKDV DSVLSDKSAL Sbjct: 149 LIISVSIGPPNIQFLKSKDKKTWAAKDVADSVLSDKSAL 187 >ref|XP_004160856.1| PREDICTED: psbP domain-containing protein 5, chloroplastic-like [Cucumis sativus] Length = 296 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPNS F+KS DK+ W AKDV DSVLSDKSAL Sbjct: 151 LIISVTIGPPNSIFIKSKDKSTWAAKDVADSVLSDKSAL 189 >ref|XP_004138754.1| PREDICTED: psbP domain-containing protein 5, chloroplastic-like [Cucumis sativus] Length = 296 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPNS F+KS DK+ W AKDV DSVLSDKSAL Sbjct: 151 LIISVTIGPPNSIFIKSKDKSTWAAKDVADSVLSDKSAL 189 >ref|XP_002516607.1| conserved hypothetical protein [Ricinus communis] gi|223544427|gb|EEF45948.1| conserved hypothetical protein [Ricinus communis] Length = 251 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L V IGPPN +F+KS DK+ W AKDV DSVLSDKSAL Sbjct: 147 LIISVTIGPPNVQFIKSKDKSTWVAKDVADSVLSDKSAL 185 >gb|EMJ24521.1| hypothetical protein PRUPE_ppa009525mg [Prunus persica] Length = 288 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKSAL 432 L + IGPPNS+ +KS DK+ W AKDV DSVL+DKSAL Sbjct: 143 LIISISIGPPNSKIIKSLDKSTWTAKDVADSVLADKSAL 181 >gb|ABK26604.1| unknown [Picea sitchensis] Length = 312 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +1 Query: 316 LTFLVQIGPPNSRFLKSGDKNAWNAKDVVDSVLSDKS 426 L V IGPPN RFL S DKN W+A+DV DSVLSDKS Sbjct: 167 LVISVSIGPPNYRFLTSKDKNTWDAEDVADSVLSDKS 203