BLASTX nr result
ID: Stemona21_contig00018157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00018157 (689 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006340180.1| PREDICTED: cytokinin riboside 5'-monophospha... 56 9e-06 gb|AGU16436.1| L-lysine decarboxylase [Huperzia serrata] 56 9e-06 ref|XP_004251148.1| PREDICTED: cytokinin riboside 5'-monophospha... 56 9e-06 gb|AFG28180.1| lysine decarboxylase 2 [Huperzia serrata] 56 9e-06 gb|AFG28179.1| lysine decarboxylase 1 [Huperzia serrata] 56 9e-06 ref|XP_002961184.1| hypothetical protein SELMODRAFT_73749 [Selag... 56 9e-06 ref|XP_002966818.1| hypothetical protein SELMODRAFT_230940 [Sela... 56 9e-06 ref|XP_002517820.1| carboxy-lyase, putative [Ricinus communis] g... 56 9e-06 >ref|XP_006340180.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3-like [Solanum tuberosum] Length = 228 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 GGYGTLEELLEMIAWSQLGIHDKPVSIVTWSKIY 102 GGYGTLEELLE+IAWSQLGIHDKPV ++ Y Sbjct: 120 GGYGTLEELLEVIAWSQLGIHDKPVGLLNVDGYY 153 >gb|AGU16436.1| L-lysine decarboxylase [Huperzia serrata] Length = 221 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 1 GGYGTLEELLEMIAWSQLGIHDKPVSIVTWSKIY 102 GGYGTLEELLEMI WSQLGIHDKPV ++ Y Sbjct: 120 GGYGTLEELLEMITWSQLGIHDKPVGLLNVDGYY 153 >ref|XP_004251148.1| PREDICTED: cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3-like isoform 1 [Solanum lycopersicum] Length = 234 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 GGYGTLEELLEMIAWSQLGIHDKPVSIVTWSKIY 102 GGYGTLEELLE+IAWSQLGIHDKPV ++ Y Sbjct: 120 GGYGTLEELLEVIAWSQLGIHDKPVGLLNVDGYY 153 >gb|AFG28180.1| lysine decarboxylase 2 [Huperzia serrata] Length = 202 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 1 GGYGTLEELLEMIAWSQLGIHDKPVSIVTWSKIY 102 GGYGTLEELLEMI WSQLGIHDKPV ++ Y Sbjct: 120 GGYGTLEELLEMITWSQLGIHDKPVGLLNVDGYY 153 >gb|AFG28179.1| lysine decarboxylase 1 [Huperzia serrata] Length = 212 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 1 GGYGTLEELLEMIAWSQLGIHDKPVSIVTWSKIY 102 GGYGTLEELLEMI WSQLGIHDKPV ++ Y Sbjct: 120 GGYGTLEELLEMITWSQLGIHDKPVGLLNVDGYY 153 >ref|XP_002961184.1| hypothetical protein SELMODRAFT_73749 [Selaginella moellendorffii] gi|300172123|gb|EFJ38723.1| hypothetical protein SELMODRAFT_73749 [Selaginella moellendorffii] Length = 220 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 1 GGYGTLEELLEMIAWSQLGIHDKPVSIVTWSKIY 102 GGYGTLEELLEMI WSQLGIHDKPV ++ Y Sbjct: 116 GGYGTLEELLEMITWSQLGIHDKPVGLLNVDGYY 149 >ref|XP_002966818.1| hypothetical protein SELMODRAFT_230940 [Selaginella moellendorffii] gi|300164809|gb|EFJ31417.1| hypothetical protein SELMODRAFT_230940 [Selaginella moellendorffii] Length = 220 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 1 GGYGTLEELLEMIAWSQLGIHDKPVSIVTWSKIY 102 GGYGTLEELLEMI WSQLGIHDKPV ++ Y Sbjct: 116 GGYGTLEELLEMITWSQLGIHDKPVGLLNVDGYY 149 >ref|XP_002517820.1| carboxy-lyase, putative [Ricinus communis] gi|223543092|gb|EEF44627.1| carboxy-lyase, putative [Ricinus communis] Length = 218 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +1 Query: 1 GGYGTLEELLEMIAWSQLGIHDKPVSIVTWSKIY 102 GGYGTLEELLE+IAWSQLGIHDKPV ++ Y Sbjct: 115 GGYGTLEELLEIIAWSQLGIHDKPVGLLNVDGYY 148