BLASTX nr result
ID: Stemona21_contig00017765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00017765 (530 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519314.1| telomeric repeat binding protein, putative [... 57 2e-06 >ref|XP_002519314.1| telomeric repeat binding protein, putative [Ricinus communis] gi|223541629|gb|EEF43178.1| telomeric repeat binding protein, putative [Ricinus communis] Length = 637 Score = 57.4 bits (137), Expect = 2e-06 Identities = 38/107 (35%), Positives = 57/107 (53%), Gaps = 20/107 (18%) Frame = +2 Query: 245 VEKHKSIA-------EARSNDASD------GNQFDQLPTPEVCRVRETLKMSLVDLHMAV 385 ++KHK IA +AR D+ + ++FD L TPEV R +E L S +L AV Sbjct: 346 LQKHKHIAVRRRNKGQARITDSDELDLEVASSKFDTLSTPEVKRTQEMLNSSFSELQAAV 405 Query: 386 DDPLPNAVAVASNVLTSL-------TSLEEGKENQDVEDANVPVSTV 505 DDPLPNA+ VA V+ + +L E ++ +DV+ +N + V Sbjct: 406 DDPLPNALHVADTVIAEIERKNPTKEALVETQKGKDVDASNPSTNAV 452