BLASTX nr result
ID: Stemona21_contig00017755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00017755 (433 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY18444.1| Nitrilase/cyanide hydratase and apolipoprotein N-... 56 4e-06 ref|XP_004962940.1| PREDICTED: nitrilase homolog 1-like [Setaria... 56 6e-06 gb|EMT26242.1| Nitrilase-like protein [Aegilops tauschii] 56 6e-06 gb|EMS48123.1| Nitrilase-like protein 1 [Triticum urartu] 56 6e-06 ref|XP_002874554.1| hypothetical protein ARALYDRAFT_911156 [Arab... 56 6e-06 gb|EEC69329.1| hypothetical protein OsI_38431 [Oryza sativa Indi... 56 6e-06 ref|NP_001066830.1| Os12g0502500 [Oryza sativa Japonica Group] g... 56 6e-06 ref|NP_567340.1| Nitrilase/cyanide hydratase and apolipoprotein ... 56 6e-06 emb|CAB78004.1| nitrilase 1 like protein [Arabidopsis thaliana] ... 56 6e-06 gb|AFW56387.1| hypothetical protein ZEAMMB73_356013 [Zea mays] 55 7e-06 ref|XP_003575496.1| PREDICTED: nitrilase homolog 1-like [Brachyp... 55 7e-06 ref|XP_002442180.1| hypothetical protein SORBIDRAFT_08g015600 [S... 55 7e-06 gb|ACF22671.1| nitrilase [Brachypodium distachyon] 55 7e-06 gb|AFW56386.1| hypothetical protein ZEAMMB73_356013 [Zea mays] 55 7e-06 ref|NP_001141322.1| uncharacterized protein LOC100273413 [Zea ma... 55 7e-06 >gb|EOY18444.1| Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase family protein isoform 3 [Theobroma cacao] Length = 280 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYVGDLF*PSLWCHCLVSQ 311 FT VTG+AHWEILLRARAIETQCYV + F P C + Q Sbjct: 226 FTTVTGQAHWEILLRARAIETQCYVWNPFPPHFLLICPLKQ 266 >ref|XP_004962940.1| PREDICTED: nitrilase homolog 1-like [Setaria italica] Length = 320 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCYV Sbjct: 221 FTKVTGEAHWEILLRARAIETQCYV 245 >gb|EMT26242.1| Nitrilase-like protein [Aegilops tauschii] Length = 165 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCYV Sbjct: 73 FTKVTGEAHWEILLRARAIETQCYV 97 >gb|EMS48123.1| Nitrilase-like protein 1 [Triticum urartu] Length = 162 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCYV Sbjct: 64 FTKVTGEAHWEILLRARAIETQCYV 88 >ref|XP_002874554.1| hypothetical protein ARALYDRAFT_911156 [Arabidopsis lyrata subsp. lyrata] gi|297320391|gb|EFH50813.1| hypothetical protein ARALYDRAFT_911156 [Arabidopsis lyrata subsp. lyrata] Length = 307 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCYV Sbjct: 215 FTKVTGEAHWEILLRARAIETQCYV 239 >gb|EEC69329.1| hypothetical protein OsI_38431 [Oryza sativa Indica Group] Length = 323 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCYV Sbjct: 225 FTKVTGEAHWEILLRARAIETQCYV 249 >ref|NP_001066830.1| Os12g0502500 [Oryza sativa Japonica Group] gi|108862714|gb|ABA98641.2| hydrolase, carbon-nitrogen family protein, expressed [Oryza sativa Japonica Group] gi|113649337|dbj|BAF29849.1| Os12g0502500 [Oryza sativa Japonica Group] Length = 323 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCYV Sbjct: 225 FTKVTGEAHWEILLRARAIETQCYV 249 >ref|NP_567340.1| Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase family protein [Arabidopsis thaliana] gi|13926307|gb|AAK49620.1|AF372904_1 AT4g08790/T32A17_100 [Arabidopsis thaliana] gi|22137058|gb|AAM91374.1| At4g08790/T32A17_100 [Arabidopsis thaliana] gi|332657278|gb|AEE82678.1| Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase family protein [Arabidopsis thaliana] Length = 307 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCYV Sbjct: 215 FTKVTGEAHWEILLRARAIETQCYV 239 >emb|CAB78004.1| nitrilase 1 like protein [Arabidopsis thaliana] gi|7321068|emb|CAB82115.1| nitrilase 1 like protein [Arabidopsis thaliana] Length = 316 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCYV Sbjct: 215 FTKVTGEAHWEILLRARAIETQCYV 239 >gb|AFW56387.1| hypothetical protein ZEAMMB73_356013 [Zea mays] Length = 318 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTK+TGEAHWEILLRARAIETQCYV Sbjct: 220 FTKITGEAHWEILLRARAIETQCYV 244 >ref|XP_003575496.1| PREDICTED: nitrilase homolog 1-like [Brachypodium distachyon] Length = 322 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCY+ Sbjct: 224 FTKVTGEAHWEILLRARAIETQCYI 248 >ref|XP_002442180.1| hypothetical protein SORBIDRAFT_08g015600 [Sorghum bicolor] gi|241942873|gb|EES16018.1| hypothetical protein SORBIDRAFT_08g015600 [Sorghum bicolor] Length = 329 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTK+TGEAHWEILLRARAIETQCYV Sbjct: 231 FTKITGEAHWEILLRARAIETQCYV 255 >gb|ACF22671.1| nitrilase [Brachypodium distachyon] Length = 252 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTKVTGEAHWEILLRARAIETQCY+ Sbjct: 154 FTKVTGEAHWEILLRARAIETQCYI 178 >gb|AFW56386.1| hypothetical protein ZEAMMB73_356013 [Zea mays] Length = 226 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTK+TGEAHWEILLRARAIETQCYV Sbjct: 128 FTKITGEAHWEILLRARAIETQCYV 152 >ref|NP_001141322.1| uncharacterized protein LOC100273413 [Zea mays] gi|194703972|gb|ACF86070.1| unknown [Zea mays] Length = 288 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 433 FTKVTGEAHWEILLRARAIETQCYV 359 FTK+TGEAHWEILLRARAIETQCYV Sbjct: 190 FTKITGEAHWEILLRARAIETQCYV 214