BLASTX nr result
ID: Stemona21_contig00017680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00017680 (1121 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS53268.1| Nucleolysin TIAR [Triticum urartu] 59 4e-06 ref|XP_006850967.1| hypothetical protein AMTR_s00025p00204100 [A... 59 5e-06 gb|EMS59759.1| Nucleolysin TIAR [Triticum urartu] 59 5e-06 emb|CAN65009.1| hypothetical protein VITISV_027348 [Vitis vinifera] 58 8e-06 >gb|EMS53268.1| Nucleolysin TIAR [Triticum urartu] Length = 540 Score = 58.9 bits (141), Expect = 4e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 1119 ISDARVMWDNKTGRSRGFGFVSFRNQQ 1039 ISDARVMWDNKTGRSRG+GFVSFRNQQ Sbjct: 167 ISDARVMWDNKTGRSRGYGFVSFRNQQ 193 >ref|XP_006850967.1| hypothetical protein AMTR_s00025p00204100 [Amborella trichopoda] gi|548854638|gb|ERN12548.1| hypothetical protein AMTR_s00025p00204100 [Amborella trichopoda] Length = 428 Score = 58.5 bits (140), Expect = 5e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 1116 SDARVMWDNKTGRSRGFGFVSFRNQQ 1039 SDARVMWDNKTGRSRGFGFVSFRNQQ Sbjct: 167 SDARVMWDNKTGRSRGFGFVSFRNQQ 192 >gb|EMS59759.1| Nucleolysin TIAR [Triticum urartu] Length = 415 Score = 58.5 bits (140), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 1116 SDARVMWDNKTGRSRGFGFVSFRNQQVYVQ 1027 SDARVMWD KTGRSRG+GFVSFRNQQV+ + Sbjct: 150 SDARVMWDQKTGRSRGYGFVSFRNQQVFAE 179 >emb|CAN65009.1| hypothetical protein VITISV_027348 [Vitis vinifera] Length = 420 Score = 57.8 bits (138), Expect = 8e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 1116 SDARVMWDNKTGRSRGFGFVSFRNQQV 1036 SDARVMWD KTGRSRGFGFVSFRNQQV Sbjct: 165 SDARVMWDQKTGRSRGFGFVSFRNQQV 191