BLASTX nr result
ID: Stemona21_contig00016982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00016982 (511 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulg... 67 5e-14 ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabac... 75 1e-13 ref|XP_002335984.1| predicted protein [Populus trichocarpa] 63 5e-08 >ref|NP_064104.1| orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435128|ref|YP_004222346.1| hypothetical protein BevumaM_p112 [Beta vulgaris subsp. maritima] gi|346683219|ref|YP_004842151.1| hypothetical protein BemaM_p107 [Beta macrocarpa] gi|9087354|dbj|BAA99498.1| orf110b [Beta vulgaris subsp. vulgaris] gi|317905682|emb|CBJ14076.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439861|emb|CBJ17566.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148051|emb|CBJ20714.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500137|emb|CBX24956.1| hypothetical protein [Beta macrocarpa] gi|384939116|emb|CBL51962.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 67.4 bits (163), Expect(2) = 5e-14 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -3 Query: 326 LRSGFEPLTQGFSVLCSNLLSYLNHFHQVSFLHL*APY 213 LRSGFEPLTQGFSVLCSN LSYLNHF +V FLH APY Sbjct: 46 LRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPY 83 Score = 35.8 bits (81), Expect(2) = 5e-14 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 507 PPGTYRSTRSINTRTELAHP 448 P YRSTRSI TRTELAHP Sbjct: 20 PSEAYRSTRSIKTRTELAHP 39 >ref|YP_173477.1| hypothetical protein NitaMp140 [Nicotiana tabacum] gi|56806642|dbj|BAD83543.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 74.7 bits (182), Expect(3) = 1e-13 Identities = 40/58 (68%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -3 Query: 383 SLEFLPSSGSLSATPLD-QTLRSGFEPLTQGFSVLCSNLLSYLNHFHQVSFLHL*APY 213 S F+ SGSL AT + LRSGFEPLTQGFSVLCSN LSYLNHF +V FLH APY Sbjct: 56 SFTFISKSGSLPATVWTFRLLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPY 113 Score = 24.6 bits (52), Expect(3) = 1e-13 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 448 PFGHRDART 422 PFGHRDART Sbjct: 10 PFGHRDART 18 Score = 22.3 bits (46), Expect(3) = 1e-13 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = -2 Query: 477 INTRTELAHP 448 +NT+TELAHP Sbjct: 1 MNTQTELAHP 10 >ref|XP_002335984.1| predicted protein [Populus trichocarpa] Length = 86 Score = 62.8 bits (151), Expect = 5e-08 Identities = 36/55 (65%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -3 Query: 386 LSLEFLPSSGS-LSATPLDQTLRSGFEPLTQGFSVLCSNLLSYLNHFHQVSFLHL 225 LSLEF S+ S L + LRSGFEPLTQGFSVLCSNLLSYLNHF +V L + Sbjct: 23 LSLEFPNSARSRLRVLMTLRPLRSGFEPLTQGFSVLCSNLLSYLNHFPKVCVLFI 77