BLASTX nr result
ID: Stemona21_contig00016808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00016808 (420 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006492991.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_006421046.1| hypothetical protein CICLE_v10004784mg [Citr... 74 2e-11 gb|ESW35794.1| hypothetical protein PHAVU_001G265200g [Phaseolus... 73 4e-11 ref|XP_003552730.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 gb|EOY05094.1| Pentatricopeptide repeat-containing protein, puta... 71 1e-10 ref|XP_002516403.1| pentatricopeptide repeat-containing protein,... 70 4e-10 gb|EMJ24063.1| hypothetical protein PRUPE_ppa004279mg [Prunus pe... 67 2e-09 gb|EXC14264.1| hypothetical protein L484_021763 [Morus notabilis] 65 7e-09 ref|XP_003538531.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 ref|XP_002268109.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 ref|XP_002321108.2| hypothetical protein POPTR_0014s14700g [Popu... 64 3e-08 emb|CAN80932.1| hypothetical protein VITISV_017362 [Vitis vinifera] 60 2e-07 ref|XP_004298231.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_006855721.1| hypothetical protein AMTR_s00044p00151840 [A... 58 1e-06 ref|NP_193155.4| pentatricopeptide repeat-containing protein [Ar... 55 1e-05 >ref|XP_006492991.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Citrus sinensis] Length = 477 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%) Frame = -3 Query: 226 DYHQRRHRTQLVETYHYNETLRSLISELSSNNRCSAP-HLLERDGDWTEDQFWPVLRLLV 50 DYH +H T LVE+YH ++ L +LI L N + S P +L+ DGDWT+D FW V+R L Sbjct: 57 DYHSTKHTTLLVESYHEHQALNALIQRL--NKKVSCPLQILQHDGDWTKDHFWAVIRFLK 114 Query: 49 RTDRADEALQVFSLW 5 + R+ + QVF +W Sbjct: 115 NSSRSRQIPQVFDMW 129 >ref|XP_006421046.1| hypothetical protein CICLE_v10004784mg [Citrus clementina] gi|557522919|gb|ESR34286.1| hypothetical protein CICLE_v10004784mg [Citrus clementina] Length = 510 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%) Frame = -3 Query: 226 DYHQRRHRTQLVETYHYNETLRSLISELSSNNRCSAP-HLLERDGDWTEDQFWPVLRLLV 50 DYH +H T LVE+YH ++ L +LI L N + S P +L+ DGDWT+D FW V+R L Sbjct: 57 DYHSTKHTTLLVESYHEHQALNALIQRL--NKKVSCPLQILQHDGDWTKDHFWAVIRFLK 114 Query: 49 RTDRADEALQVFSLW 5 + R+ + QVF +W Sbjct: 115 NSSRSRQIPQVFDMW 129 >gb|ESW35794.1| hypothetical protein PHAVU_001G265200g [Phaseolus vulgaris] Length = 496 Score = 72.8 bits (177), Expect = 4e-11 Identities = 32/76 (42%), Positives = 50/76 (65%) Frame = -3 Query: 232 GDDYHQRRHRTQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWTEDQFWPVLRLL 53 GD +HRT LVETYH++++LR+L+++L + + ++L +DGDW++D FW +R L Sbjct: 52 GDTVSDSKHRTLLVETYHHHDSLRALLAKLEREDS-NPMYILAQDGDWSKDHFWAAVRFL 110 Query: 52 VRTDRADEALQVFSLW 5 R E LQVF +W Sbjct: 111 KNASRFVEILQVFDMW 126 >ref|XP_003552730.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Glycine max] Length = 509 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/76 (43%), Positives = 50/76 (65%), Gaps = 3/76 (3%) Frame = -3 Query: 223 YHQ---RRHRTQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWTEDQFWPVLRLL 53 YH+ +H T LVETYH +++LR+L+++L + C+ H+L DGDW++D FW V+R L Sbjct: 53 YHRFADTKHTTLLVETYHLHDSLRALLAKLQKED-CNPLHVLAEDGDWSKDHFWAVVRFL 111 Query: 52 VRTDRADEALQVFSLW 5 R + LQVF +W Sbjct: 112 KSASRFTQILQVFDMW 127 >gb|EOY05094.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 504 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/87 (41%), Positives = 51/87 (58%) Frame = -3 Query: 265 IRSTRGPPDRGGDDYHQRRHRTQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWT 86 + S R P R D + H LVETYH++ L++L+ L ++ C +L DGDWT Sbjct: 44 LSSIRPSPPRP-DGSSCKNHTALLVETYHHHRRLKALLERLEKDDSCPL-QMLRDDGDWT 101 Query: 85 EDQFWPVLRLLVRTDRADEALQVFSLW 5 +D FW V+R L R R++E LQVF +W Sbjct: 102 KDIFWVVIRFLRRASRSNEILQVFHMW 128 >ref|XP_002516403.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544501|gb|EEF46020.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 502 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/69 (42%), Positives = 46/69 (66%) Frame = -3 Query: 211 RHRTQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWTEDQFWPVLRLLVRTDRAD 32 +H T LVE+YH ++ L++L++ L+ C +L+ D DW++D FW V+R L + R+D Sbjct: 56 KHNTLLVESYHEHQRLKALLARLNKKGSCPL-QMLQDDADWSKDHFWAVIRFLRHSSRSD 114 Query: 31 EALQVFSLW 5 E LQVF +W Sbjct: 115 EILQVFDMW 123 >gb|EMJ24063.1| hypothetical protein PRUPE_ppa004279mg [Prunus persica] Length = 518 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/74 (44%), Positives = 45/74 (60%) Frame = -3 Query: 226 DYHQRRHRTQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWTEDQFWPVLRLLVR 47 D +H T LVET+H ++ L++L+ L N C LL DGDWT+DQFW +R L Sbjct: 66 DSSSTKHTTLLVETFHEHQRLKALLQNLI-NGSCPL-QLLGEDGDWTKDQFWAAIRFLKH 123 Query: 46 TDRADEALQVFSLW 5 T R +E LQ+F +W Sbjct: 124 TFRFNEILQLFDMW 137 >gb|EXC14264.1| hypothetical protein L484_021763 [Morus notabilis] Length = 664 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = -3 Query: 208 HRTQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWTEDQFWPVLRLLVRTDRADE 29 H T LVET+H + ++L+ LS N+ C LL DGDW ++ FW V+R L R E Sbjct: 63 HTTLLVETFHEHRKFKTLLKRLSKNDSCPM-RLLREDGDWCKEHFWAVVRFLRHGSRTKE 121 Query: 28 ALQVFSLW 5 +QVF LW Sbjct: 122 IVQVFDLW 129 >ref|XP_003538531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like isoform X1 [Glycine max] Length = 506 Score = 65.1 bits (157), Expect = 9e-09 Identities = 33/77 (42%), Positives = 47/77 (61%), Gaps = 4/77 (5%) Frame = -3 Query: 223 YHQ---RRHRTQLVETYHYNETLRSLISELSSNNRCSAP-HLLERDGDWTEDQFWPVLRL 56 YH+ +H T LVETYH + +LR+L+++L N S P H+L D DW++D FW V+R Sbjct: 51 YHRFADTKHTTLLVETYHLHHSLRALLAKLE--NEYSNPLHMLAEDADWSKDHFWAVVRF 108 Query: 55 LVRTDRADEALQVFSLW 5 L + LQVF +W Sbjct: 109 LKSSSNFTHILQVFDMW 125 >ref|XP_002268109.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Vitis vinifera] Length = 581 Score = 65.1 bits (157), Expect = 9e-09 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Frame = -3 Query: 211 RHRTQLVETYHYNETLRSLISELSSNNRCSAP-HLLERDGDWTEDQFWPVLRLLVRTDRA 35 +H T LVET H NE L LI +LS N+ S+P LL DGDW + FW V+R L R+ Sbjct: 88 KHTTLLVETLHENERLGVLIQKLS--NKASSPLQLLRDDGDWNKQHFWAVIRFLKDASRS 145 Query: 34 DEALQVFSLW 5 E L VF LW Sbjct: 146 SEILPVFHLW 155 >ref|XP_002321108.2| hypothetical protein POPTR_0014s14700g [Populus trichocarpa] gi|550324215|gb|EEE99423.2| hypothetical protein POPTR_0014s14700g [Populus trichocarpa] Length = 508 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/71 (40%), Positives = 49/71 (69%) Frame = -3 Query: 220 HQRRHRTQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWTEDQFWPVLRLLVRTD 41 H +H T LV+++H ++ L+SL+ L+SN + LL++DGDW++D FW V++ L + Sbjct: 48 HSTKHTTLLVDSFHEHKRLKSLLHNLNSNQ--NPLQLLQQDGDWSKDDFWSVIKFLKLSA 105 Query: 40 RADEALQVFSL 8 R+++ LQV SL Sbjct: 106 RSNQILQVHSL 116 >emb|CAN80932.1| hypothetical protein VITISV_017362 [Vitis vinifera] Length = 1697 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/65 (50%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = -3 Query: 196 LVETYHYNETLRSLISELSSNNRCSAP-HLLERDGDWTEDQFWPVLRLLVRTDRADEALQ 20 LVET H NE L LI +LS N+ S+P LL DGDW + FW V+R L R+ E L Sbjct: 1332 LVETLHENERLGVLIQKLS--NKASSPLQLLRDDGDWNKQHFWAVIRFLKDASRSSEILP 1389 Query: 19 VFSLW 5 VF LW Sbjct: 1390 VFHLW 1394 >ref|XP_004298231.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14190, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 509 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/68 (44%), Positives = 37/68 (54%) Frame = -3 Query: 208 HRTQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWTEDQFWPVLRLLVRTDRADE 29 H T VE H LR+L+ L + C LL DGDWT DQFW V+R L+ R E Sbjct: 68 HTTLHVEPSHEYHKLRALLDILMEKDCCPL-QLLRDDGDWTIDQFWAVIRFLIHASRPKE 126 Query: 28 ALQVFSLW 5 LQ+F +W Sbjct: 127 ILQLFDIW 134 >ref|XP_006855721.1| hypothetical protein AMTR_s00044p00151840 [Amborella trichopoda] gi|548859508|gb|ERN17188.1| hypothetical protein AMTR_s00044p00151840 [Amborella trichopoda] Length = 506 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/70 (38%), Positives = 39/70 (55%) Frame = -3 Query: 211 RHRTQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWTEDQFWPVLRLLVRTDRAD 32 +HR LV+ + + L LI ++ LL +GDW +DQFW V++LL T R Sbjct: 64 KHRALLVQNFFQTQQLLDLIEKIKGG--IDPLKLLRDEGDWNKDQFWAVMKLLKETSRIK 121 Query: 31 EALQVFSLWI 2 EA+QVF W+ Sbjct: 122 EAMQVFDYWV 131 >ref|NP_193155.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635638|sp|O23278.2|PP310_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g14190, chloroplastic; Flags: Precursor gi|332657991|gb|AEE83391.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 501 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/66 (40%), Positives = 36/66 (54%) Frame = -3 Query: 202 TQLVETYHYNETLRSLISELSSNNRCSAPHLLERDGDWTEDQFWPVLRLLVRTDRADEAL 23 TQ H++ L SL LS + C LL+ DGDW++D FW V+R L ++ R E L Sbjct: 57 TQPTSLLHHHRFLSSLTRRLSLSGSCPL-RLLQEDGDWSKDHFWAVIRFLRQSSRLHEIL 115 Query: 22 QVFSLW 5 VF W Sbjct: 116 PVFDTW 121