BLASTX nr result
ID: Stemona21_contig00015943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00015943 (1506 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL10325.1| DWARF8 [Zea mays subsp. mays] 61 1e-06 ref|XP_004982031.1| PREDICTED: DELLA protein DWARF8-like [Setari... 61 1e-06 sp|Q9ST48.1|DWRF8_MAIZE RecName: Full=DELLA protein DWARF8; Shor... 61 1e-06 tpg|DAA50918.1| TPA: dwarf plant8 [Zea mays] 61 1e-06 gb|AFK24644.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24642.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24641.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24638.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24635.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24633.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24632.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24630.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24629.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24627.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24626.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24624.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24623.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24617.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24616.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 gb|AFK24612.1| PgDwarf8, partial [Cenchrus americanus] 61 1e-06 >gb|AAL10325.1| DWARF8 [Zea mays subsp. mays] Length = 581 Score = 61.2 bits (147), Expect = 1e-06 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTVRLRE 1087 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV +E Sbjct: 443 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTVVKQE 482 >ref|XP_004982031.1| PREDICTED: DELLA protein DWARF8-like [Setaria italica] Length = 621 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 438 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 473 >sp|Q9ST48.1|DWRF8_MAIZE RecName: Full=DELLA protein DWARF8; Short=Protein dwarf-8 gi|5640155|emb|CAB51557.1| gibberellin response modulator [Zea mays] gi|219884989|gb|ACL52869.1| unknown [Zea mays] gi|414872363|tpg|DAA50920.1| TPA: dwarf plant8 [Zea mays] Length = 630 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 443 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 478 >tpg|DAA50918.1| TPA: dwarf plant8 [Zea mays] Length = 584 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 397 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 432 >gb|AFK24644.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24642.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24641.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24638.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24635.1| PgDwarf8, partial [Cenchrus americanus] Length = 409 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24633.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24632.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24630.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24629.1| PgDwarf8, partial [Cenchrus americanus] Length = 409 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24627.1| PgDwarf8, partial [Cenchrus americanus] Length = 409 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24626.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24624.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24623.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24617.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24616.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357 >gb|AFK24612.1| PgDwarf8, partial [Cenchrus americanus] Length = 410 Score = 60.8 bits (146), Expect = 1e-06 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 968 VAVNSVLELHRLSAQPSALEKVLGTVRAMQPRIVTV 1075 +AVNSV ELHRL AQP ALEKVLGTVRA++PRIVTV Sbjct: 322 IAVNSVFELHRLLAQPGALEKVLGTVRAVRPRIVTV 357