BLASTX nr result
ID: Stemona21_contig00015717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00015717 (1298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001145699.1| putative ABC1 and kinase-like domain family ... 58 1e-05 >ref|NP_001145699.1| putative ABC1 and kinase-like domain family protein [Zea mays] gi|219884079|gb|ACL52414.1| unknown [Zea mays] gi|414590541|tpg|DAA41112.1| TPA: putative ABC1 and kinase-like domain family protein [Zea mays] Length = 624 Score = 57.8 bits (138), Expect = 1e-05 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 7/59 (11%) Frame = +3 Query: 54 LFDTSQNHA------ICSLLF-LQFL*GWQSKLDPNFDIMRTLKTLLLKEDWAQPIDYF 209 L DT + H IC+++ + L GWQ KLDP FDIM+TLKTLLL++D QPID+F Sbjct: 565 LLDTVRRHKVNIDGNICTVMVTILVLEGWQRKLDPGFDIMQTLKTLLLEKDIKQPIDFF 623