BLASTX nr result
ID: Stemona21_contig00014958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00014958 (919 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002867035.1| oxidoreductase [Arabidopsis lyrata subsp. ly... 65 3e-08 ref|XP_006425503.1| hypothetical protein CICLE_v10025381mg [Citr... 65 4e-08 ref|XP_006466940.1| PREDICTED: uncharacterized protein LOC102616... 65 5e-08 ref|XP_006283482.1| hypothetical protein CARUB_v10004530mg [Caps... 64 6e-08 ref|NP_001031794.1| oxidoreductase, 2OG-Fe(II) oxygenase family ... 63 1e-07 ref|NP_001031793.1| oxidoreductase, 2OG-Fe(II) oxygenase family ... 63 1e-07 emb|CAA18503.1| hypothetical protein [Arabidopsis thaliana] gi|7... 63 1e-07 ref|XP_002891469.1| hypothetical protein ARALYDRAFT_314327 [Arab... 60 2e-06 gb|ESW33110.1| hypothetical protein PHAVU_001G044000g, partial [... 57 7e-06 gb|ESW33109.1| hypothetical protein PHAVU_001G044000g, partial [... 57 7e-06 ref|XP_002447374.1| hypothetical protein SORBIDRAFT_06g033940 [S... 57 7e-06 >ref|XP_002867035.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297312871|gb|EFH43294.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Length = 490 Score = 65.5 bits (158), Expect = 3e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYDSTTKRLP 120 RISITFRKMD+SK P GF+PEPDLQ I+PLPY+ TT+ P Sbjct: 379 RISITFRKMDESKRPVGFTPEPDLQGIKPLPYEQTTQSTP 418 >ref|XP_006425503.1| hypothetical protein CICLE_v10025381mg [Citrus clementina] gi|557527493|gb|ESR38743.1| hypothetical protein CICLE_v10025381mg [Citrus clementina] Length = 515 Score = 65.1 bits (157), Expect = 4e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYDSTTKRL 117 RISITFRKMD+SK PFGF PEPDLQ IQPLPYD+ ++ Sbjct: 422 RISITFRKMDESKCPFGFVPEPDLQGIQPLPYDAEKPKI 460 >ref|XP_006466940.1| PREDICTED: uncharacterized protein LOC102616828 [Citrus sinensis] Length = 515 Score = 64.7 bits (156), Expect = 5e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYDSTTKRL 117 RISITFRKMD+SK PFGF PEPDLQ IQPLPYD+ ++ Sbjct: 422 RISITFRKMDESKRPFGFVPEPDLQGIQPLPYDAEKPKI 460 >ref|XP_006283482.1| hypothetical protein CARUB_v10004530mg [Capsella rubella] gi|482552187|gb|EOA16380.1| hypothetical protein CARUB_v10004530mg [Capsella rubella] Length = 545 Score = 64.3 bits (155), Expect = 6e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYDSTTKRLPQL 126 RISITFRKMD+SK P GF+PEPDLQ I+PLPY+ T +P + Sbjct: 432 RISITFRKMDESKRPVGFTPEPDLQGIEPLPYEQNTPSVPDV 473 >ref|NP_001031794.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] gi|55819794|gb|AAV66092.1| At4g36090 [Arabidopsis thaliana] gi|59958356|gb|AAX12888.1| At4g36090 [Arabidopsis thaliana] gi|332661217|gb|AEE86617.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] Length = 520 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYDSTTKRLP 120 RISITFRKMD+SK P GF+PEPDL+ I+PLPY+ TT P Sbjct: 409 RISITFRKMDESKRPVGFTPEPDLEEIKPLPYEHTTPSTP 448 >ref|NP_001031793.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] gi|51971445|dbj|BAD44387.1| hypothetical protein [Arabidopsis thaliana] gi|332661216|gb|AEE86616.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] Length = 452 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYDSTTKRLP 120 RISITFRKMD+SK P GF+PEPDL+ I+PLPY+ TT P Sbjct: 341 RISITFRKMDESKRPVGFTPEPDLEEIKPLPYEHTTPSTP 380 >emb|CAA18503.1| hypothetical protein [Arabidopsis thaliana] gi|7270561|emb|CAB81518.1| hypothetical protein [Arabidopsis thaliana] Length = 505 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYDSTTKRLP 120 RISITFRKMD+SK P GF+PEPDL+ I+PLPY+ TT P Sbjct: 394 RISITFRKMDESKRPVGFTPEPDLEEIKPLPYEHTTPSTP 433 >ref|XP_002891469.1| hypothetical protein ARALYDRAFT_314327 [Arabidopsis lyrata subsp. lyrata] gi|297337311|gb|EFH67728.1| hypothetical protein ARALYDRAFT_314327 [Arabidopsis lyrata subsp. lyrata] Length = 335 Score = 59.7 bits (143), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYD 99 RISITFRKMD+SKWP F+PEP LQ IQPLPY+ Sbjct: 289 RISITFRKMDESKWPVWFTPEPYLQGIQPLPYE 321 >gb|ESW33110.1| hypothetical protein PHAVU_001G044000g, partial [Phaseolus vulgaris] Length = 519 Score = 57.4 bits (137), Expect = 7e-06 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYDSTTKRLPQLETSGPHQ 147 RISITFR+MD+S+ PFG+ PEPDLQ IQPL Y+ + Q + SG H+ Sbjct: 423 RISITFRRMDESRRPFGYVPEPDLQGIQPLAYE----EVEQEKKSGGHR 467 >gb|ESW33109.1| hypothetical protein PHAVU_001G044000g, partial [Phaseolus vulgaris] Length = 521 Score = 57.4 bits (137), Expect = 7e-06 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLPYDSTTKRLPQLETSGPHQ 147 RISITFR+MD+S+ PFG+ PEPDLQ IQPL Y+ + Q + SG H+ Sbjct: 425 RISITFRRMDESRRPFGYVPEPDLQGIQPLAYE----EVEQEKKSGGHR 469 >ref|XP_002447374.1| hypothetical protein SORBIDRAFT_06g033940 [Sorghum bicolor] gi|241938557|gb|EES11702.1| hypothetical protein SORBIDRAFT_06g033940 [Sorghum bicolor] Length = 345 Score = 57.4 bits (137), Expect = 7e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 RISITFRKMDDSKWPFGFSPEPDLQNIQPLP 93 RISITFRKMD +K PFGF P+PDLQN+QPLP Sbjct: 227 RISITFRKMDAAKLPFGFRPDPDLQNLQPLP 257