BLASTX nr result
ID: Stemona21_contig00014839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00014839 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB88402.1| hypothetical protein L484_007685 [Morus notabilis] 56 6e-06 >gb|EXB88402.1| hypothetical protein L484_007685 [Morus notabilis] Length = 371 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 338 DTKRKFCTFPFEEYAWRVYHERFSLKDPLLRYRI 237 + KR F +F FE+YAWRVYHERF +KDPL RYRI Sbjct: 337 EEKRLFNSFSFEDYAWRVYHERFPIKDPLDRYRI 370