BLASTX nr result
ID: Stemona21_contig00014227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00014227 (291 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846994.1| hypothetical protein AMTR_s00017p00130610 [A... 64 3e-08 ref|XP_002280997.2| PREDICTED: DDB1- and CUL4-associated factor ... 60 3e-07 emb|CBI20820.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_006355221.1| PREDICTED: DDB1- and CUL4-associated factor ... 58 1e-06 ref|XP_006355220.1| PREDICTED: DDB1- and CUL4-associated factor ... 58 1e-06 gb|ESW09096.1| hypothetical protein PHAVU_009G099700g [Phaseolus... 58 1e-06 ref|XP_004246232.1| PREDICTED: DDB1- and CUL4-associated factor ... 58 1e-06 gb|EOY29098.1| DDB1-CUL4 associated factor 1 [Theobroma cacao] 57 2e-06 ref|XP_006282988.1| hypothetical protein CARUB_v10003973mg [Caps... 56 4e-06 dbj|BAC43043.1| unknown protein [Arabidopsis thaliana] 56 4e-06 ref|XP_003603512.1| DDB1- and CUL4-associated factor-like protei... 56 4e-06 ref|XP_002869342.1| transducin family protein [Arabidopsis lyrat... 56 4e-06 ref|NP_194845.4| DDB1- and CUL4-associated factor-1 [Arabidopsis... 56 4e-06 emb|CAB79834.1| putative protein [Arabidopsis thaliana] 56 4e-06 ref|XP_006483658.1| PREDICTED: DDB1- and CUL4-associated factor ... 55 7e-06 ref|XP_006450073.1| hypothetical protein CICLE_v10007230mg [Citr... 55 7e-06 ref|XP_004959951.1| PREDICTED: DDB1- and CUL4-associated factor ... 55 7e-06 >ref|XP_006846994.1| hypothetical protein AMTR_s00017p00130610 [Amborella trichopoda] gi|548850023|gb|ERN08575.1| hypothetical protein AMTR_s00017p00130610 [Amborella trichopoda] Length = 1863 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSFVGVVAMDDHE+MY+SAR+YE+GRRR Sbjct: 1719 TEPTDSFVGVVAMDDHEEMYASARIYEVGRRR 1750 >ref|XP_002280997.2| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Vitis vinifera] Length = 2024 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSFVG+V+MDDH++M+SSAR+YEIGRRR Sbjct: 1878 TEPTDSFVGLVSMDDHDEMFSSARMYEIGRRR 1909 >emb|CBI20820.3| unnamed protein product [Vitis vinifera] Length = 1760 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSFVG+V+MDDH++M+SSAR+YEIGRRR Sbjct: 1614 TEPTDSFVGLVSMDDHDEMFSSARMYEIGRRR 1645 >ref|XP_006355221.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X2 [Solanum tuberosum] Length = 1877 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSFVG+V MDD ++MYSSAR+YEIGRRR Sbjct: 1739 TEPTDSFVGLVTMDDQDEMYSSARVYEIGRRR 1770 >ref|XP_006355220.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X1 [Solanum tuberosum] Length = 1964 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSFVG+V MDD ++MYSSAR+YEIGRRR Sbjct: 1826 TEPTDSFVGLVTMDDQDEMYSSARVYEIGRRR 1857 >gb|ESW09096.1| hypothetical protein PHAVU_009G099700g [Phaseolus vulgaris] Length = 1938 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSFVG++ MDD E+MY+SAR+YEIGRRR Sbjct: 1792 TEPTDSFVGLITMDDQEEMYASARIYEIGRRR 1823 >ref|XP_004246232.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Solanum lycopersicum] Length = 1921 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSFVG+V MDD ++MYSSAR+YEIGRRR Sbjct: 1783 TEPTDSFVGLVTMDDQDEMYSSARVYEIGRRR 1814 >gb|EOY29098.1| DDB1-CUL4 associated factor 1 [Theobroma cacao] Length = 1976 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSFVG++ MDD E+M+SSAR+YEIGRRR Sbjct: 1835 TEPTDSFVGLITMDDQEEMFSSARVYEIGRRR 1866 >ref|XP_006282988.1| hypothetical protein CARUB_v10003973mg [Capsella rubella] gi|482551693|gb|EOA15886.1| hypothetical protein CARUB_v10003973mg [Capsella rubella] Length = 1921 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRR Sbjct: 1767 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRR 1798 >dbj|BAC43043.1| unknown protein [Arabidopsis thaliana] Length = 225 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRR Sbjct: 80 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRR 111 >ref|XP_003603512.1| DDB1- and CUL4-associated factor-like protein [Medicago truncatula] gi|355492560|gb|AES73763.1| DDB1- and CUL4-associated factor-like protein [Medicago truncatula] Length = 805 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSFVG++ MDD DMYSSAR YEIGRRR Sbjct: 664 TEPTDSFVGLITMDDQGDMYSSARSYEIGRRR 695 >ref|XP_002869342.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297315178|gb|EFH45601.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Length = 1872 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRR Sbjct: 1723 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRR 1754 >ref|NP_194845.4| DDB1- and CUL4-associated factor-1 [Arabidopsis thaliana] gi|290463428|sp|Q9M086.2|DCAF1_ARATH RecName: Full=DDB1- and CUL4-associated factor homolog 1; AltName: Full=Protein DDB1-CUL4 ASSOCIATED FACTOR 1; Short=Protein DCAF1 gi|332660467|gb|AEE85867.1| DDB1- and CUL4-associated factor-1 [Arabidopsis thaliana] Length = 1883 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRR Sbjct: 1738 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRR 1769 >emb|CAB79834.1| putative protein [Arabidopsis thaliana] Length = 1846 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRR Sbjct: 1701 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRR 1732 >ref|XP_006483658.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Citrus sinensis] Length = 1922 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+ TDSFVG++ MDD EDM+SSAR+YEIGRRR Sbjct: 1783 TERTDSFVGLITMDDQEDMFSSARIYEIGRRR 1814 >ref|XP_006450073.1| hypothetical protein CICLE_v10007230mg [Citrus clementina] gi|557553299|gb|ESR63313.1| hypothetical protein CICLE_v10007230mg [Citrus clementina] Length = 1922 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+ TDSFVG++ MDD EDM+SSAR+YEIGRRR Sbjct: 1783 TERTDSFVGLITMDDQEDMFSSARIYEIGRRR 1814 >ref|XP_004959951.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Setaria italica] Length = 1914 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/32 (68%), Positives = 30/32 (93%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRR 98 T+P DS +GVVAMDDHE+++SSARL+E+GR+R Sbjct: 1773 TEPNDSLIGVVAMDDHEELFSSARLFEVGRKR 1804