BLASTX nr result
ID: Stemona21_contig00014226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00014226 (288 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846994.1| hypothetical protein AMTR_s00017p00130610 [A... 68 1e-09 ref|XP_002280997.2| PREDICTED: DDB1- and CUL4-associated factor ... 65 1e-08 emb|CBI20820.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_006355221.1| PREDICTED: DDB1- and CUL4-associated factor ... 62 6e-08 ref|XP_006355220.1| PREDICTED: DDB1- and CUL4-associated factor ... 62 6e-08 gb|ESW09096.1| hypothetical protein PHAVU_009G099700g [Phaseolus... 62 6e-08 ref|XP_004246232.1| PREDICTED: DDB1- and CUL4-associated factor ... 62 6e-08 gb|EOY29098.1| DDB1-CUL4 associated factor 1 [Theobroma cacao] 62 1e-07 ref|XP_006282988.1| hypothetical protein CARUB_v10003973mg [Caps... 61 2e-07 dbj|BAC43043.1| unknown protein [Arabidopsis thaliana] 61 2e-07 ref|XP_003603512.1| DDB1- and CUL4-associated factor-like protei... 61 2e-07 ref|XP_002869342.1| transducin family protein [Arabidopsis lyrat... 61 2e-07 ref|NP_194845.4| DDB1- and CUL4-associated factor-1 [Arabidopsis... 61 2e-07 emb|CAB79834.1| putative protein [Arabidopsis thaliana] 61 2e-07 ref|XP_006483658.1| PREDICTED: DDB1- and CUL4-associated factor ... 60 3e-07 ref|XP_006450073.1| hypothetical protein CICLE_v10007230mg [Citr... 60 3e-07 ref|XP_006581396.1| PREDICTED: DDB1- and CUL4-associated factor ... 59 5e-07 ref|XP_006578187.1| PREDICTED: DDB1- and CUL4-associated factor ... 59 5e-07 ref|XP_006578186.1| PREDICTED: DDB1- and CUL4-associated factor ... 59 5e-07 ref|XP_006412623.1| hypothetical protein EUTSA_v10024189mg [Eutr... 59 5e-07 >ref|XP_006846994.1| hypothetical protein AMTR_s00017p00130610 [Amborella trichopoda] gi|548850023|gb|ERN08575.1| hypothetical protein AMTR_s00017p00130610 [Amborella trichopoda] Length = 1863 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSFVGVVAMDDHE+MY+SAR+YE+GRRRPT Sbjct: 1719 TEPTDSFVGVVAMDDHEEMYASARIYEVGRRRPT 1752 >ref|XP_002280997.2| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Vitis vinifera] Length = 2024 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/34 (79%), Positives = 34/34 (100%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSFVG+V+MDDH++M+SSAR+YEIGRRRPT Sbjct: 1878 TEPTDSFVGLVSMDDHDEMFSSARMYEIGRRRPT 1911 >emb|CBI20820.3| unnamed protein product [Vitis vinifera] Length = 1760 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/34 (79%), Positives = 34/34 (100%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSFVG+V+MDDH++M+SSAR+YEIGRRRPT Sbjct: 1614 TEPTDSFVGLVSMDDHDEMFSSARMYEIGRRRPT 1647 >ref|XP_006355221.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X2 [Solanum tuberosum] Length = 1877 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSFVG+V MDD ++MYSSAR+YEIGRRRPT Sbjct: 1739 TEPTDSFVGLVTMDDQDEMYSSARVYEIGRRRPT 1772 >ref|XP_006355220.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X1 [Solanum tuberosum] Length = 1964 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSFVG+V MDD ++MYSSAR+YEIGRRRPT Sbjct: 1826 TEPTDSFVGLVTMDDQDEMYSSARVYEIGRRRPT 1859 >gb|ESW09096.1| hypothetical protein PHAVU_009G099700g [Phaseolus vulgaris] Length = 1938 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSFVG++ MDD E+MY+SAR+YEIGRRRPT Sbjct: 1792 TEPTDSFVGLITMDDQEEMYASARIYEIGRRRPT 1825 >ref|XP_004246232.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Solanum lycopersicum] Length = 1921 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSFVG+V MDD ++MYSSAR+YEIGRRRPT Sbjct: 1783 TEPTDSFVGLVTMDDQDEMYSSARVYEIGRRRPT 1816 >gb|EOY29098.1| DDB1-CUL4 associated factor 1 [Theobroma cacao] Length = 1976 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSFVG++ MDD E+M+SSAR+YEIGRRRPT Sbjct: 1835 TEPTDSFVGLITMDDQEEMFSSARVYEIGRRRPT 1868 >ref|XP_006282988.1| hypothetical protein CARUB_v10003973mg [Capsella rubella] gi|482551693|gb|EOA15886.1| hypothetical protein CARUB_v10003973mg [Capsella rubella] Length = 1921 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRRPT Sbjct: 1767 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRRPT 1800 >dbj|BAC43043.1| unknown protein [Arabidopsis thaliana] Length = 225 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRRPT Sbjct: 80 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRRPT 113 >ref|XP_003603512.1| DDB1- and CUL4-associated factor-like protein [Medicago truncatula] gi|355492560|gb|AES73763.1| DDB1- and CUL4-associated factor-like protein [Medicago truncatula] Length = 805 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSFVG++ MDD DMYSSAR YEIGRRRPT Sbjct: 664 TEPTDSFVGLITMDDQGDMYSSARSYEIGRRRPT 697 >ref|XP_002869342.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297315178|gb|EFH45601.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Length = 1872 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRRPT Sbjct: 1723 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRRPT 1756 >ref|NP_194845.4| DDB1- and CUL4-associated factor-1 [Arabidopsis thaliana] gi|290463428|sp|Q9M086.2|DCAF1_ARATH RecName: Full=DDB1- and CUL4-associated factor homolog 1; AltName: Full=Protein DDB1-CUL4 ASSOCIATED FACTOR 1; Short=Protein DCAF1 gi|332660467|gb|AEE85867.1| DDB1- and CUL4-associated factor-1 [Arabidopsis thaliana] Length = 1883 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRRPT Sbjct: 1738 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRRPT 1771 >emb|CAB79834.1| putative protein [Arabidopsis thaliana] Length = 1846 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSF+G++ M+D EDM+SSAR+YEIGRRRPT Sbjct: 1701 TEPTDSFLGLITMEDQEDMFSSARMYEIGRRRPT 1734 >ref|XP_006483658.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Citrus sinensis] Length = 1922 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+ TDSFVG++ MDD EDM+SSAR+YEIGRRRPT Sbjct: 1783 TERTDSFVGLITMDDQEDMFSSARIYEIGRRRPT 1816 >ref|XP_006450073.1| hypothetical protein CICLE_v10007230mg [Citrus clementina] gi|557553299|gb|ESR63313.1| hypothetical protein CICLE_v10007230mg [Citrus clementina] Length = 1922 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+ TDSFVG++ MDD EDM+SSAR+YEIGRRRPT Sbjct: 1783 TERTDSFVGLITMDDQEDMFSSARIYEIGRRRPT 1816 >ref|XP_006581396.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Glycine max] Length = 1923 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 6 DPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 +PTDSFVG++ MDD ++MY+SAR+YEIGRRRPT Sbjct: 1780 EPTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1812 >ref|XP_006578187.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X2 [Glycine max] gi|571449580|ref|XP_006578188.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X3 [Glycine max] Length = 1938 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 6 DPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 +PTDSFVG++ MDD ++MY+SAR+YEIGRRRPT Sbjct: 1795 EPTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1827 >ref|XP_006578186.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X1 [Glycine max] Length = 1941 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 6 DPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 +PTDSFVG++ MDD ++MY+SAR+YEIGRRRPT Sbjct: 1798 EPTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1830 >ref|XP_006412623.1| hypothetical protein EUTSA_v10024189mg [Eutrema salsugineum] gi|557113793|gb|ESQ54076.1| hypothetical protein EUTSA_v10024189mg [Eutrema salsugineum] Length = 1938 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +3 Query: 3 TDPTDSFVGVVAMDDHEDMYSSARLYEIGRRRPT 104 T+PTDSF+G++ M+D E+M+SSAR+YEIGRRRPT Sbjct: 1799 TEPTDSFLGLITMEDQEEMFSSARMYEIGRRRPT 1832