BLASTX nr result
ID: Stemona21_contig00013275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00013275 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB44476.1| hypothetical protein L484_013894 [Morus notabilis] 59 7e-07 gb|EMT21027.1| hypothetical protein F775_18206 [Aegilops tauschii] 54 8e-06 ref|XP_003562611.1| PREDICTED: protein notum homolog isoform 1 [... 54 8e-06 ref|XP_003562612.1| PREDICTED: protein notum homolog isoform 2 [... 54 8e-06 >gb|EXB44476.1| hypothetical protein L484_013894 [Morus notabilis] Length = 315 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 319 NLFLH*INIVSLQCFFPQNVLASIQTPLFLLNTAYDVWQ 203 NLF +VSLQCFFPQN++A+++TPLFLLN AYD WQ Sbjct: 245 NLFA---GVVSLQCFFPQNLIANVKTPLFLLNAAYDAWQ 280 >gb|EMT21027.1| hypothetical protein F775_18206 [Aegilops tauschii] Length = 415 Score = 53.9 bits (128), Expect(2) = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 280 CFFPQNVLASIQTPLFLLNTAYDVWQV 200 CFFPQNVL +IQTP F+LNTAYDVWQ+ Sbjct: 267 CFFPQNVLPNIQTPTFILNTAYDVWQL 293 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 399 RSCTSQMDAT 370 RSCTS+MD T Sbjct: 256 RSCTSRMDKT 265 >ref|XP_003562611.1| PREDICTED: protein notum homolog isoform 1 [Brachypodium distachyon] Length = 412 Score = 53.9 bits (128), Expect(2) = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 280 CFFPQNVLASIQTPLFLLNTAYDVWQV 200 CFFPQNVL +IQTP F+LNTAYDVWQ+ Sbjct: 264 CFFPQNVLPNIQTPTFILNTAYDVWQL 290 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 399 RSCTSQMDAT 370 RSCTS+MD T Sbjct: 253 RSCTSRMDKT 262 >ref|XP_003562612.1| PREDICTED: protein notum homolog isoform 2 [Brachypodium distachyon] Length = 344 Score = 53.9 bits (128), Expect(2) = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 280 CFFPQNVLASIQTPLFLLNTAYDVWQV 200 CFFPQNVL +IQTP F+LNTAYDVWQ+ Sbjct: 196 CFFPQNVLPNIQTPTFILNTAYDVWQL 222 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 399 RSCTSQMDAT 370 RSCTS+MD T Sbjct: 185 RSCTSRMDKT 194