BLASTX nr result
ID: Stemona21_contig00013145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00013145 (429 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC41688.1| unknown [Musa acuminata] 62 1e-07 ref|XP_004146250.1| PREDICTED: uncharacterized protein LOC101222... 57 2e-06 gb|EXB38001.1| hypothetical protein L484_004791 [Morus notabilis] 57 3e-06 ref|XP_002517907.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 gb|ABK23005.1| unknown [Picea sitchensis] 57 3e-06 gb|ABK21749.1| unknown [Picea sitchensis] 57 3e-06 ref|XP_006447297.1| hypothetical protein CICLE_v10017871mg [Citr... 56 4e-06 gb|AFG45331.1| hypothetical protein 2_8958_01, partial [Pinus ta... 56 6e-06 gb|AEW08406.1| hypothetical protein 2_8958_01, partial [Pinus ra... 56 6e-06 >gb|ABC41688.1| unknown [Musa acuminata] Length = 92 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 ARVWPRQLIGDLVLALSWALFLFYSWREKYD 93 AR WPRQL+GDLVL+LSW LFL YSWREKYD Sbjct: 62 ARDWPRQLVGDLVLSLSWVLFLVYSWREKYD 92 >ref|XP_004146250.1| PREDICTED: uncharacterized protein LOC101222658 [Cucumis sativus] gi|449525359|ref|XP_004169685.1| PREDICTED: uncharacterized LOC101222658 [Cucumis sativus] Length = 144 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +1 Query: 1 ARVWPRQLIGDLVLALSWALFLFYSWREKYD 93 AR WPRQ++GD+ LALSW FL YSWREKYD Sbjct: 114 ARDWPRQVVGDVTLALSWVFFLVYSWREKYD 144 >gb|EXB38001.1| hypothetical protein L484_004791 [Morus notabilis] Length = 120 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +1 Query: 10 WPRQLIGDLVLALSWALFLFYSWREKYD 93 WP+Q+IGDLVLALSW FL YSWREKYD Sbjct: 93 WPKQVIGDLVLALSWVFFLVYSWREKYD 120 >ref|XP_002517907.1| conserved hypothetical protein [Ricinus communis] gi|223542889|gb|EEF44425.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = +1 Query: 10 WPRQLIGDLVLALSWALFLFYSWREKYD 93 WP+Q+IGDL+LALSW FL YSWREKYD Sbjct: 43 WPKQMIGDLILALSWVFFLVYSWREKYD 70 >gb|ABK23005.1| unknown [Picea sitchensis] Length = 143 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +1 Query: 1 ARVWPRQLIGDLVLALSWALFLFYSWREKYD 93 AR WPRQL+GD++++LSW FL Y+WREKYD Sbjct: 113 ARDWPRQLVGDIIMSLSWVFFLVYNWREKYD 143 >gb|ABK21749.1| unknown [Picea sitchensis] Length = 143 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +1 Query: 1 ARVWPRQLIGDLVLALSWALFLFYSWREKYD 93 AR WPRQL+GD++++LSW FL Y+WREKYD Sbjct: 113 ARDWPRQLVGDIIMSLSWVFFLVYNWREKYD 143 >ref|XP_006447297.1| hypothetical protein CICLE_v10017871mg [Citrus clementina] gi|568884556|ref|XP_006494945.1| PREDICTED: uncharacterized protein LOC102626090 [Citrus sinensis] gi|557549908|gb|ESR60537.1| hypothetical protein CICLE_v10017871mg [Citrus clementina] Length = 144 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = +1 Query: 10 WPRQLIGDLVLALSWALFLFYSWREKYD 93 WPRQ++GDL LALSW FL YSWREKYD Sbjct: 117 WPRQVVGDLALALSWVFFLVYSWREKYD 144 >gb|AFG45331.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129279|gb|AFG45332.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129281|gb|AFG45333.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129283|gb|AFG45334.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129285|gb|AFG45335.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129287|gb|AFG45336.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129289|gb|AFG45337.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129291|gb|AFG45338.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129293|gb|AFG45339.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129295|gb|AFG45340.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129297|gb|AFG45341.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129299|gb|AFG45342.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129301|gb|AFG45343.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129303|gb|AFG45344.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129305|gb|AFG45345.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129307|gb|AFG45346.1| hypothetical protein 2_8958_01, partial [Pinus taeda] gi|383129309|gb|AFG45347.1| hypothetical protein 2_8958_01, partial [Pinus taeda] Length = 103 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = +1 Query: 1 ARVWPRQLIGDLVLALSWALFLFYSWREKYD 93 AR WPRQ++GD++++LSW FL Y+WREKYD Sbjct: 73 ARDWPRQVVGDIIMSLSWVFFLVYNWREKYD 103 >gb|AEW08406.1| hypothetical protein 2_8958_01, partial [Pinus radiata] Length = 103 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = +1 Query: 1 ARVWPRQLIGDLVLALSWALFLFYSWREKYD 93 AR WPRQ++GD++++LSW FL Y+WREKYD Sbjct: 73 ARDWPRQVVGDIIMSLSWVFFLVYNWREKYD 103