BLASTX nr result
ID: Stemona21_contig00012590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00012590 (384 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY06552.1| Pollen Ole e 1 allergen and extensin family prote... 57 2e-06 ref|XP_006298502.1| hypothetical protein CARUB_v10014579mg, part... 56 6e-06 >gb|EOY06552.1| Pollen Ole e 1 allergen and extensin family protein, putative [Theobroma cacao] Length = 158 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/49 (53%), Positives = 39/49 (79%) Frame = -3 Query: 382 LVVQTPLATCNASLPAIGGILQSPLQLLTGSLSGILGVLNLVPAGFALV 236 L V+TPL+ CNA+LP++GG++ S LQ L +L G+L ++N+VPAGF L+ Sbjct: 108 LAVKTPLSNCNAALPSVGGLISS-LQSLGSTLVGLLNIINIVPAGFRLL 155 >ref|XP_006298502.1| hypothetical protein CARUB_v10014579mg, partial [Capsella rubella] gi|482567211|gb|EOA31400.1| hypothetical protein CARUB_v10014579mg, partial [Capsella rubella] Length = 222 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/50 (50%), Positives = 40/50 (80%) Frame = -3 Query: 382 LVVQTPLATCNASLPAIGGILQSPLQLLTGSLSGILGVLNLVPAGFALVH 233 +VV TPL+TCNA LP++G ++ S L ++ SLSG+L ++N++PAGF L++ Sbjct: 174 VVVTTPLSTCNAELPSVGSLV-SQLTMIGSSLSGLLRIVNIIPAGFNLLN 222