BLASTX nr result
ID: Stemona21_contig00012262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Stemona21_contig00012262 (270 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS49892.1| Putative disease resistance protein RGA1 [Triticu... 56 4e-06 >gb|EMS49892.1| Putative disease resistance protein RGA1 [Triticum urartu] Length = 1300 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 269 RLPHLQYLSIWGCPLLEGRCKEGGDYWHLLSSIP 168 RLP L++LS++GCP LE RC EGG+Y+HLLSSIP Sbjct: 1185 RLPALEHLSLYGCPELERRCGEGGEYFHLLSSIP 1218